Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093510
Gene name
Locationscaffold_6:1359021..1361956
Strand-
Gene length (bp)2935
Transcript length (bp)2883
Coding sequence length (bp)2883
Protein length (aa) 961

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P38928|AXL2_YEAST Axial budding pattern protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=AXL2 PE=1 SV=1 25 418 7.0E-23

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

Domain # Start End Length
1 473 495 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093510
MLVALSTLMSLIPGIRTTTVIVHNPLNNQLPTLARVNKYWTWSPSSDTFYSPGDQLKYTALGLPHWMAFDEWSFM
FAGTPSEQDEGCNDVTLTAHGSSSSASSRVSLCVSRNPLPLPRLSIATQFSPENPSISSAFFLSPGSSLTTSGEP
CLRIPSKWSFSIGFEYNTFDHDPGDPSSDDFYYGVKQVNGSALPDWMTFNTRELTLNGVTPAEKDLPTPATFHLG
LYASEQEGYSAVNMPFCVIVASHELSAASPMSTVNITAGVPFKIDLNSPADFSGIFLDNKPIHAQNISKLTIDVS
GYDGWLLYNPANRTLSGNPKPELAGQSLTLPVDISTPFNQGIRTNVSIAIVPSYFTEGDFPTIYAGPGDKISFNL
SQYFSNSSGGDLDLSMIYEPTDVESFLTLSNGSTLEGTVPDNFPTVHILVTFTAFSRVTHSTSHASLAIFVTASG
SQDRTPKGRWGGLSGNQHSRLVLALAIIFGILGGLCLIGGILAVVRRMARVEDTALTGEEGRNALSDKDRKWYGL
DGTPTRRSKWAGLSPKLSSLDGKIGLGLRRIPERSGRNQAGSSSAQSSGVLSKREFFAKLKQTVRYVSDKYSPNR
KPFSSDSLTPQIVERPIIVRTKTAPPTVESLPFQHVIDAYATKPFGGASNVGSANLSHSSSSSTANYSIPQRRGD
FGKPKGKTQVHFDEGQYLRPSSRTSSRSNKSLTVFSQDSPLVGVITDVSPASPAPATLRPRLVPFTSATRVLVPS
SSLNDGIDTTDPAVNNVFAGGQRIASQKAKIVRMPESGGDGDGVKKSGSGDELRVGLRYVQALGADNQPGAVISP
GAISNMQSSFSSLDSSNAGHNGLVGTPTEKRVLVTPGQKFKFFVRIPPVSIAARAQGVTTSTPVILPREYNVKII
SGQPLSQLHVDLNGIETRGTAEVTGESTREDIGVITFGIYAGRNSEVCLAMVIIEVAETR*
Coding >AgabiH97|093510
ATGCTAGTCGCTCTTTCCACCCTTATGAGTCTGATTCCCGGTATTCGAACAACAACGGTGATTGTGCATAACCCT
TTGAACAATCAACTCCCTACGCTTGCCCGCGTCAATAAGTACTGGACATGGTCTCCTTCTTCGGATACGTTTTAT
TCTCCCGGCGATCAACTCAAATACACTGCATTGGGTTTACCACACTGGATGGCTTTCGACGAGTGGAGTTTTATG
TTTGCCGGGACGCCCTCGGAACAAGATGAAGGCTGCAACGACGTCACGCTTACTGCTCATGGATCATCCTCTTCC
GCTTCTTCTCGAGTCTCTCTCTGCGTCTCTCGGAATCCATTGCCGCTTCCAAGGTTATCCATCGCGACTCAGTTT
TCCCCTGAAAATCCTTCGATATCCTCAGCGTTTTTCCTTTCTCCAGGATCTAGTCTCACAACCTCTGGCGAGCCT
TGCCTTAGAATCCCGTCAAAATGGTCTTTCAGTATAGGTTTTGAGTACAACACATTCGACCACGACCCCGGCGAC
CCTTCGAGCGACGATTTTTACTATGGAGTCAAACAGGTCAACGGTAGCGCACTTCCGGACTGGATGACATTCAAT
ACCAGAGAGCTCACTTTAAACGGAGTTACACCCGCGGAAAAGGATCTCCCAACGCCGGCTACTTTCCATCTAGGG
CTCTACGCGTCTGAACAAGAGGGATATTCTGCGGTTAACATGCCTTTCTGTGTCATTGTTGCGAGCCATGAACTC
TCTGCTGCTTCCCCAATGTCTACTGTCAACATCACTGCTGGAGTCCCTTTCAAGATTGACTTGAACTCTCCTGCC
GACTTCTCGGGAATATTCTTGGATAACAAACCCATTCACGCGCAAAACATTTCAAAATTAACGATTGATGTGTCT
GGCTACGATGGCTGGCTGTTGTACAATCCTGCGAATCGCACCTTGTCTGGAAACCCGAAGCCGGAACTTGCTGGG
CAAAGTCTGACACTGCCAGTGGATATCAGCACTCCTTTCAATCAGGGGATCAGGACCAACGTCTCTATTGCAATC
GTCCCCTCTTATTTCACTGAAGGAGATTTTCCGACGATATATGCTGGACCGGGGGACAAGATTTCGTTTAACCTC
TCGCAATACTTCTCTAACTCGTCCGGTGGAGATTTGGATTTGTCAATGATCTATGAACCGACGGACGTTGAATCC
TTCCTCACTCTCTCTAATGGGTCCACACTGGAAGGTACTGTCCCGGATAATTTCCCCACGGTACACATTCTTGTT
ACATTCACGGCATTTTCGCGCGTCACACACTCAACTTCGCATGCCAGTCTAGCAATCTTCGTTACTGCGTCTGGG
AGTCAGGACAGAACTCCCAAGGGACGATGGGGTGGGCTCTCTGGGAATCAGCACTCGAGACTTGTTTTGGCTTTA
GCGATTATTTTTGGGATTCTGGGAGGGCTATGTCTGATTGGTGGGATCCTGGCTGTTGTGAGAAGAATGGCTAGA
GTTGAAGATACTGCACTTACCGGAGAAGAAGGCAGGAATGCTTTGAGTGATAAGGATAGGAAGTGGTATGGGCTT
GATGGCACTCCGACTCGTCGGAGCAAGTGGGCTGGGTTGTCGCCGAAACTTAGTTCCCTCGATGGAAAGATAGGC
TTGGGTTTGCGAAGAATCCCAGAACGGAGCGGGCGAAATCAGGCTGGATCATCGAGCGCGCAAAGTTCGGGCGTT
CTAAGCAAGCGGGAGTTCTTTGCAAAGCTGAAGCAAACAGTGAGATACGTCAGCGATAAATACTCTCCGAACCGG
AAGCCATTCAGTTCAGATAGTCTGACTCCTCAGATTGTTGAGAGACCCATTATCGTGAGGACGAAGACGGCACCT
CCTACGGTGGAAAGCTTACCTTTTCAGCATGTGATCGATGCATATGCAACGAAACCATTTGGAGGGGCAAGTAAC
GTAGGAAGTGCAAATTTGTCGCATTCGTCCTCGTCATCCACCGCCAACTACTCCATTCCCCAACGGCGGGGAGAT
TTTGGCAAACCAAAAGGCAAGACACAAGTTCATTTCGACGAAGGGCAATATCTACGTCCGAGTTCAAGAACAAGC
TCGAGGAGTAACAAGAGCCTCACTGTCTTTTCGCAGGATTCACCTCTAGTAGGTGTAATTACCGATGTGTCGCCA
GCGTCGCCTGCCCCTGCCACGTTGCGCCCTAGGCTCGTGCCATTCACGAGTGCTACACGAGTTCTAGTTCCCTCG
TCGTCACTAAACGATGGTATAGATACTACGGATCCTGCGGTCAATAATGTATTCGCAGGGGGTCAGCGGATTGCG
AGCCAGAAAGCAAAGATTGTGAGAATGCCAGAGTCGGGTGGGGATGGGGATGGTGTAAAAAAAAGTGGGAGTGGA
GATGAACTCAGGGTGGGCCTTCGGTATGTCCAGGCGCTTGGAGCAGATAATCAGCCTGGGGCCGTCATTTCACCT
GGCGCGATTTCAAACATGCAATCCTCGTTTTCGTCTTTGGACTCCTCGAATGCAGGACACAATGGGCTCGTGGGT
ACTCCAACAGAAAAACGAGTACTAGTGACACCTGGTCAGAAGTTTAAATTCTTTGTTCGGATTCCACCAGTGTCA
ATTGCAGCCAGGGCTCAGGGCGTAACGACATCGACGCCAGTTATACTGCCTCGCGAATACAACGTGAAAATCATT
TCGGGACAACCTTTATCTCAGCTGCATGTCGATCTAAACGGAATTGAAACGAGGGGAACTGCAGAAGTTACGGGA
GAAAGCACGAGGGAGGATATTGGGGTTATCACATTTGGAATCTATGCTGGACGAAACAGTGAGGTTTGTCTAGCA
ATGGTCATTATTGAAGTTGCAGAAACACGGTGA
Transcript >AgabiH97|093510
ATGCTAGTCGCTCTTTCCACCCTTATGAGTCTGATTCCCGGTATTCGAACAACAACGGTGATTGTGCATAACCCT
TTGAACAATCAACTCCCTACGCTTGCCCGCGTCAATAAGTACTGGACATGGTCTCCTTCTTCGGATACGTTTTAT
TCTCCCGGCGATCAACTCAAATACACTGCATTGGGTTTACCACACTGGATGGCTTTCGACGAGTGGAGTTTTATG
TTTGCCGGGACGCCCTCGGAACAAGATGAAGGCTGCAACGACGTCACGCTTACTGCTCATGGATCATCCTCTTCC
GCTTCTTCTCGAGTCTCTCTCTGCGTCTCTCGGAATCCATTGCCGCTTCCAAGGTTATCCATCGCGACTCAGTTT
TCCCCTGAAAATCCTTCGATATCCTCAGCGTTTTTCCTTTCTCCAGGATCTAGTCTCACAACCTCTGGCGAGCCT
TGCCTTAGAATCCCGTCAAAATGGTCTTTCAGTATAGGTTTTGAGTACAACACATTCGACCACGACCCCGGCGAC
CCTTCGAGCGACGATTTTTACTATGGAGTCAAACAGGTCAACGGTAGCGCACTTCCGGACTGGATGACATTCAAT
ACCAGAGAGCTCACTTTAAACGGAGTTACACCCGCGGAAAAGGATCTCCCAACGCCGGCTACTTTCCATCTAGGG
CTCTACGCGTCTGAACAAGAGGGATATTCTGCGGTTAACATGCCTTTCTGTGTCATTGTTGCGAGCCATGAACTC
TCTGCTGCTTCCCCAATGTCTACTGTCAACATCACTGCTGGAGTCCCTTTCAAGATTGACTTGAACTCTCCTGCC
GACTTCTCGGGAATATTCTTGGATAACAAACCCATTCACGCGCAAAACATTTCAAAATTAACGATTGATGTGTCT
GGCTACGATGGCTGGCTGTTGTACAATCCTGCGAATCGCACCTTGTCTGGAAACCCGAAGCCGGAACTTGCTGGG
CAAAGTCTGACACTGCCAGTGGATATCAGCACTCCTTTCAATCAGGGGATCAGGACCAACGTCTCTATTGCAATC
GTCCCCTCTTATTTCACTGAAGGAGATTTTCCGACGATATATGCTGGACCGGGGGACAAGATTTCGTTTAACCTC
TCGCAATACTTCTCTAACTCGTCCGGTGGAGATTTGGATTTGTCAATGATCTATGAACCGACGGACGTTGAATCC
TTCCTCACTCTCTCTAATGGGTCCACACTGGAAGGTACTGTCCCGGATAATTTCCCCACGGTACACATTCTTGTT
ACATTCACGGCATTTTCGCGCGTCACACACTCAACTTCGCATGCCAGTCTAGCAATCTTCGTTACTGCGTCTGGG
AGTCAGGACAGAACTCCCAAGGGACGATGGGGTGGGCTCTCTGGGAATCAGCACTCGAGACTTGTTTTGGCTTTA
GCGATTATTTTTGGGATTCTGGGAGGGCTATGTCTGATTGGTGGGATCCTGGCTGTTGTGAGAAGAATGGCTAGA
GTTGAAGATACTGCACTTACCGGAGAAGAAGGCAGGAATGCTTTGAGTGATAAGGATAGGAAGTGGTATGGGCTT
GATGGCACTCCGACTCGTCGGAGCAAGTGGGCTGGGTTGTCGCCGAAACTTAGTTCCCTCGATGGAAAGATAGGC
TTGGGTTTGCGAAGAATCCCAGAACGGAGCGGGCGAAATCAGGCTGGATCATCGAGCGCGCAAAGTTCGGGCGTT
CTAAGCAAGCGGGAGTTCTTTGCAAAGCTGAAGCAAACAGTGAGATACGTCAGCGATAAATACTCTCCGAACCGG
AAGCCATTCAGTTCAGATAGTCTGACTCCTCAGATTGTTGAGAGACCCATTATCGTGAGGACGAAGACGGCACCT
CCTACGGTGGAAAGCTTACCTTTTCAGCATGTGATCGATGCATATGCAACGAAACCATTTGGAGGGGCAAGTAAC
GTAGGAAGTGCAAATTTGTCGCATTCGTCCTCGTCATCCACCGCCAACTACTCCATTCCCCAACGGCGGGGAGAT
TTTGGCAAACCAAAAGGCAAGACACAAGTTCATTTCGACGAAGGGCAATATCTACGTCCGAGTTCAAGAACAAGC
TCGAGGAGTAACAAGAGCCTCACTGTCTTTTCGCAGGATTCACCTCTAGTAGGTGTAATTACCGATGTGTCGCCA
GCGTCGCCTGCCCCTGCCACGTTGCGCCCTAGGCTCGTGCCATTCACGAGTGCTACACGAGTTCTAGTTCCCTCG
TCGTCACTAAACGATGGTATAGATACTACGGATCCTGCGGTCAATAATGTATTCGCAGGGGGTCAGCGGATTGCG
AGCCAGAAAGCAAAGATTGTGAGAATGCCAGAGTCGGGTGGGGATGGGGATGGTGTAAAAAAAAGTGGGAGTGGA
GATGAACTCAGGGTGGGCCTTCGGTATGTCCAGGCGCTTGGAGCAGATAATCAGCCTGGGGCCGTCATTTCACCT
GGCGCGATTTCAAACATGCAATCCTCGTTTTCGTCTTTGGACTCCTCGAATGCAGGACACAATGGGCTCGTGGGT
ACTCCAACAGAAAAACGAGTACTAGTGACACCTGGTCAGAAGTTTAAATTCTTTGTTCGGATTCCACCAGTGTCA
ATTGCAGCCAGGGCTCAGGGCGTAACGACATCGACGCCAGTTATACTGCCTCGCGAATACAACGTGAAAATCATT
TCGGGACAACCTTTATCTCAGCTGCATGTCGATCTAAACGGAATTGAAACGAGGGGAACTGCAGAAGTTACGGGA
GAAAGCACGAGGGAGGATATTGGGGTTATCACATTTGGAATCTATGCTGGACGAAACAGTGAGGTTTGTCTAGCA
ATGGTCATTATTGAAGTTGCAGAAACACGGTGA
Gene >AgabiH97|093510
ATGCTAGTCGCTCTTTCCACCCTTATGAGTCTGATTCCCGGTATTCGAACAACAACGGTGATTGTGCATAACCCT
TTGAACAATCAACTCCCTACGCTTGCCCGCGTCAATAAGTACTGGACATGGTCTCCTTCTTCGGATACGTTTTAT
TCTCCCGGCGATCAACTCAAATACACTGCATTGGGTTTACCACACTGGATGGCTTTCGACGAGTGGAGTTTTATG
TTTGCCGGGACGCCCTCGGAACAAGATGAAGGCTGCAACGACGTCACGCTTACTGCTCATGGATCATCCTCTTCC
GCTTCTTCTCGAGTCTCTCTCTGCGTCTCTCGGAATCCATTGCCGCTTCCAAGGTTATCCATCGCGACTCAGTTT
TCCCCTGAAAATCCTTCGATATCCTCAGCGTTTTTCCTTTCTCCAGGATCTAGTCTCACAACCTCTGGCGAGCCT
TGCCTTAGAATCCCGTCAAAATGGTCTTTCAGTATAGGTTTTGAGTACAACACATTCGACCACGACCCCGGCGAC
CCTTCGAGCGACGATTTTTACTATGGAGTCAAACAGGTCAACGGTAGCGCACTTCCGGACTGGATGACATTCAAT
ACCAGAGAGCTCACTTTAAACGGAGTTACACCCGCGGAAAAGGATCTCCCAACGCCGGCTACTTTCCATCTAGGG
CTCTACGCGTCTGAACAAGAGGGATATTCTGCGGTTAACATGCCTTTCTGTGTCATTGTTGCGAGCCATGAACTC
TCTGCTGCTTCCCCAATGTCTACTGTCAACATCACTGCTGGAGTCCCTTTCAAGATTGACTTGAACTCTCCTGCC
GACTTCTCGGGAATATTCTTGGATAACAAACCCATTCACGCGCAAAACATTTCAAAATTAACGATTGATGTGTCT
GGCTACGATGGCTGGCTGTTGTACAATCCTGCGAATCGCACCTTGTCTGGAAACCCGAAGCCGGAACTTGCTGGG
CAAAGTCTGACACTGCCAGTGGATATCAGCACTCCTTTCAATCAGGGGATCAGGACCAACGTCTCTATTGCAATC
GTCCCCTCTTATTTCACTGAAGGAGATTTTCCGACGATATATGCTGGACCGGGGGACAAGATTTCGTTTAACCTC
TCGCAATACTTCTCTAACTCGTCCGGTGGAGATTTGGATTTGTCAATGATCTATGAACCGACGGACGTTGAATCC
TTCCTCACTCTCTCTAATGGGTCCACACTGGAAGGTACTGTCCCGGATAATTTCCCCACGGTACACATTCTTGTT
ACATTCACGGCATTTTCGCGCGTCACACACTCAACTTCGCATGCCAGTCTAGCAATCTTCGTTACTGCGTCTGGG
AGTCAGGACAGAACTCCCAAGGGACGATGGGGTGGGCTCTCTGGGAATCAGCACTCGAGACTTGTTTTGGCTTTA
GCGATTATTTTTGGGATTCTGGGAGGGCTATGTCTGATTGGTGGGATCCTGGCTGTTGTGAGAAGAATGGCTAGA
GTTGAAGATACTGCACTTACCGGAGAAGAAGGCAGGAATGCTTTGAGTGATAAGGATAGGAAGTGGTATGGGCTT
GATGGCACTCCGACTCGTCGGAGCAAGTGGGCTGGGTTGTCGCCGAAACTTAGTTCCCTCGATGGAAAGATAGGC
TTGGGTTTGCGAAGAATCCCAGAACGGAGCGGGCGAAATCAGGCTGGATCATCGAGCGCGCAAAGTTCGGGCGTT
CTAAGCAAGCGGGAGTTCTTTGCAAAGCTGAAGCAAACAGTGAGATACGTCAGCGATAAATACTCTCCGAACCGG
AAGCCATTCAGTTCAGATAGTCTGACTCCTCAGATTGTTGAGAGACCCATTATCGTGAGGACGAAGACGGCACCT
CCTACGGTGGAAAGCTTACCTTTTCAGCATGTGATCGATGCATATGCAACGAAACCATTTGGAGGGGCAAGTAAC
GTAGGAAGTGCAAATTTGTCGCATTCGTCCTCGTCATCCACCGCCAACTACTCCATTCCCCAACGGCGGGGAGAT
TTTGGCAAACCAAAAGGCAAGACACAAGTTCATTTCGACGAAGGTATGTCTAAAGATTAAACTTGGACTAATTGG
TGAGCTGAAGAGTTAATTAGGGCAATATCTACGTCCGAGTTCAAGAACAAGCTCGAGGAGTAACAAGAGCCTCAC
TGTCTTTTCGCAGGATTCACCTCTAGTAGGTGTAATTACCGATGTGTCGCCAGCGTCGCCTGCCCCTGCCACGTT
GCGCCCTAGGCTCGTGCCATTCACGAGTGCTACACGAGTTCTAGTTCCCTCGTCGTCACTAAACGATGGTATAGA
TACTACGGATCCTGCGGTCAATAATGTATTCGCAGGGGGTCAGCGGATTGCGAGCCAGAAAGCAAAGATTGTGAG
AATGCCAGAGTCGGGTGGGGATGGGGATGGTGTAAAAAAAAGTGGGAGTGGAGATGAACTCAGGGTGGGCCTTCG
GTATGTCCAGGCGCTTGGAGCAGATAATCAGCCTGGGGCCGTCATTTCACCTGGCGCGATTTCAAACATGCAATC
CTCGTTTTCGTCTTTGGACTCCTCGAATGCAGGACACAATGGGCTCGTGGGTACTCCAACAGAAAAACGAGTACT
AGTGACACCTGGTCAGAAGTTTAAATTCTTTGTTCGGATTCCACCAGTGTCAATTGCAGCCAGGGCTCAGGGCGT
AACGACATCGACGCCAGTTATACTGCCTCGCGAATACAACGTGAAAATCATTTCGGGACAACCTTTATCTCAGCT
GCATGTCGATCTAAACGGAATTGAAACGAGGGGAACTGCAGAAGTTACGGGAGAAAGCACGAGGGAGGATATTGG
GGTTATCACATTTGGAATCTATGCTGGACGAAACAGTGAGGTTTGTCTAGCAATGGTCATTATTGAAGTTGCAGA
AACACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail