Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093390
Gene name
Locationscaffold_6:1323509..1325978
Strand+
Gene length (bp)2469
Transcript length (bp)1599
Coding sequence length (bp)1599
Protein length (aa) 533

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01546 Peptidase_M20 Peptidase family M20/M25/M40 7.7E-31 117 524
PF07687 M20_dimer Peptidase dimerisation domain 8.2E-12 237 381
PF04389 Peptidase_M28 Peptidase family M28 2.6E-05 102 202

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 33 528 2.0E-121
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 44 531 9.0E-116
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 38 527 3.0E-108
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 77 528 7.0E-64
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 48 530 2.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P27614|CBPS_YEAST Carboxypeptidase S OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CPS1 PE=1 SV=2 33 528 2.0E-121
sp|P0C155|CBPS2_YEAST Putative carboxypeptidase YOL153C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YOL153C PE=5 SV=1 44 531 9.0E-116
sp|O13968|YE48_SCHPO Uncharacterized carboxypeptidase C24C9.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC24C9.08 PE=3 SV=1 38 527 3.0E-108
sp|Q55FR8|CBPS2_DICDI Probable carboxypeptidase S-like 2 OS=Dictyostelium discoideum GN=DDB_G0267984 PE=3 SV=1 77 528 7.0E-64
sp|Q2T9M7|P20D1_BOVIN Probable carboxypeptidase PM20D1 OS=Bos taurus GN=PM20D1 PE=2 SV=1 48 530 2.0E-60
sp|Q8C165|P20D1_MOUSE Probable carboxypeptidase PM20D1 OS=Mus musculus GN=Pm20d1 PE=1 SV=1 48 527 3.0E-58
sp|Q55DL1|CBPS1_DICDI Probable carboxypeptidase S-like 1 OS=Dictyostelium discoideum GN=DDB_G0270582 PE=3 SV=1 71 525 5.0E-54
sp|Q08BB2|P2012_DANRE Probable carboxypeptidase PM20D1.2 OS=Danio rerio GN=pm20d1.2 PE=2 SV=1 51 527 1.0E-53
sp|Q5ZL18|P20D1_CHICK Probable carboxypeptidase PM20D1 OS=Gallus gallus GN=PM20D1 PE=2 SV=1 28 527 4.0E-53
sp|Q08BT9|P20D1_XENTR Probable carboxypeptidase PM20D1 OS=Xenopus tropicalis GN=pm20d1 PE=2 SV=1 41 527 3.0E-51
sp|Q32LT9|P2011_DANRE Probable carboxypeptidase PM20D1.1 OS=Danio rerio GN=pm20d1.1 PE=2 SV=1 38 527 3.0E-47
sp|Q6GTS8|P20D1_HUMAN Probable carboxypeptidase PM20D1 OS=Homo sapiens GN=PM20D1 PE=2 SV=3 48 527 2.0E-45
sp|Q7VRT2|DAPE_BLOFL Succinyl-diaminopimelate desuccinylase OS=Blochmannia floridanus GN=dapE PE=3 SV=1 104 272 9.0E-12
sp|B3H2U3|DAPE_ACTP7 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=dapE PE=3 SV=1 116 278 3.0E-11
sp|A3N3G9|DAPE_ACTP2 Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dapE PE=3 SV=1 116 278 3.0E-11
sp|Q99SN6|DAPE_STAAN Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain N315) GN=dapE PE=1 SV=1 41 519 3.0E-11
sp|Q6GF48|DAPE_STAAR Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MRSA252) GN=dapE PE=3 SV=1 41 519 7.0E-11
sp|Q8NVL7|DAPE_STAAW Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MW2) GN=dapE PE=3 SV=1 41 519 8.0E-11
sp|Q6G7T6|DAPE_STAAS Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain MSSA476) GN=dapE PE=3 SV=1 41 519 8.0E-11
sp|Q7VNB3|DAPE_HAEDU Succinyl-diaminopimelate desuccinylase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dapE PE=3 SV=1 116 278 1.0E-10
sp|Q6AYS7|ACY1A_RAT Aminoacylase-1A OS=Rattus norvegicus GN=Acy1a PE=1 SV=1 82 221 3.0E-10
sp|Q99JW2|ACY1_MOUSE Aminoacylase-1 OS=Mus musculus GN=Acy1 PE=1 SV=1 82 257 3.0E-10
sp|B0BTF3|DAPE_ACTPJ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dapE PE=3 SV=1 116 274 1.0E-09
sp|B0UT10|DAPE_HISS2 Succinyl-diaminopimelate desuccinylase OS=Histophilus somni (strain 2336) GN=dapE PE=3 SV=1 108 276 1.0E-09
sp|Q9CM22|DAPE_PASMU Succinyl-diaminopimelate desuccinylase OS=Pasteurella multocida (strain Pm70) GN=dapE PE=3 SV=1 115 278 1.0E-09
sp|Q65US9|DAPE_MANSM Succinyl-diaminopimelate desuccinylase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dapE PE=3 SV=1 116 293 2.0E-09
sp|Q931I4|DAPE_STAAM Probable succinyl-diaminopimelate desuccinylase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dapE PE=3 SV=1 41 368 3.0E-09
sp|A1SXF9|DAPE_PSYIN Succinyl-diaminopimelate desuccinylase OS=Psychromonas ingrahamii (strain 37) GN=dapE PE=3 SV=1 106 271 4.0E-09
sp|A9BZY6|DAPE_DELAS Succinyl-diaminopimelate desuccinylase OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dapE PE=3 SV=1 114 259 4.0E-09
sp|B8F824|DAPE_HAEPS Succinyl-diaminopimelate desuccinylase OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dapE PE=3 SV=1 109 274 9.0E-09
sp|B9MJL1|DAPE_ACIET Succinyl-diaminopimelate desuccinylase OS=Acidovorax ebreus (strain TPSY) GN=dapE PE=3 SV=1 114 280 2.0E-08
sp|Q0I1X3|DAPE_HAES1 Succinyl-diaminopimelate desuccinylase OS=Haemophilus somnus (strain 129Pt) GN=dapE PE=3 SV=1 108 276 2.0E-08
sp|A1W7M0|DAPE_ACISJ Succinyl-diaminopimelate desuccinylase OS=Acidovorax sp. (strain JS42) GN=dapE PE=3 SV=1 114 271 2.0E-08
sp|Q8D2S2|DAPE_WIGBR Succinyl-diaminopimelate desuccinylase OS=Wigglesworthia glossinidia brevipalpis GN=dapE PE=3 SV=1 103 205 3.0E-08
sp|Q5RFB0|ACY1_PONAB Aminoacylase-1 OS=Pongo abelii GN=ACY1 PE=2 SV=2 80 257 3.0E-08
sp|Q03154|ACY1_HUMAN Aminoacylase-1 OS=Homo sapiens GN=ACY1 PE=1 SV=1 103 257 4.0E-08
sp|Q4FU86|DAPE_PSYA2 Succinyl-diaminopimelate desuccinylase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=dapE PE=3 SV=1 103 374 4.0E-08
sp|A5CCZ1|DAPE_ORITB Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Boryong) GN=dapE PE=3 SV=1 116 280 5.0E-08
sp|Q21WT4|DAPE_RHOFT Succinyl-diaminopimelate desuccinylase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=dapE PE=3 SV=1 114 282 7.0E-08
sp|Q6PTT0|ACY1B_RAT Aminoacylase-1B OS=Rattus norvegicus GN=Acy1b PE=1 SV=1 103 221 7.0E-08
sp|B3CRZ3|DAPE_ORITI Succinyl-diaminopimelate desuccinylase OS=Orientia tsutsugamushi (strain Ikeda) GN=dapE PE=3 SV=1 116 272 1.0E-07
sp|A9ILD7|DAPE_BART1 Succinyl-diaminopimelate desuccinylase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=dapE PE=3 SV=1 116 201 1.0E-07
sp|C5CLT2|DAPE_VARPS Succinyl-diaminopimelate desuccinylase OS=Variovorax paradoxus (strain S110) GN=dapE PE=3 SV=1 108 205 1.0E-07
sp|B9JZL9|DAPE_AGRVS Succinyl-diaminopimelate desuccinylase OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dapE PE=3 SV=1 116 291 1.0E-07
sp|Q2Y7X4|DAPE_NITMU Succinyl-diaminopimelate desuccinylase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=dapE PE=3 SV=1 106 521 1.0E-07
sp|Q6G567|DAPE_BARHE Succinyl-diaminopimelate desuccinylase OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dapE PE=3 SV=1 116 201 2.0E-07
sp|Q6G1H9|DAPE_BARQU Succinyl-diaminopimelate desuccinylase OS=Bartonella quintana (strain Toulouse) GN=dapE PE=3 SV=1 112 201 2.0E-07
sp|Q1QDC1|DAPE_PSYCK Succinyl-diaminopimelate desuccinylase OS=Psychrobacter cryohalolentis (strain K5) GN=dapE PE=3 SV=1 116 285 2.0E-07
sp|B2JID9|DAPE_BURP8 Succinyl-diaminopimelate desuccinylase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dapE PE=3 SV=1 112 401 2.0E-07
sp|B2VE50|DAPE_ERWT9 Succinyl-diaminopimelate desuccinylase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dapE PE=3 SV=1 104 217 3.0E-07
sp|A5CXE9|DAPE_VESOH Succinyl-diaminopimelate desuccinylase OS=Vesicomyosocius okutanii subsp. Calyptogena okutanii (strain HA) GN=dapE PE=3 SV=1 91 282 3.0E-07
sp|Q2SX11|DAPE_BURTA Succinyl-diaminopimelate desuccinylase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dapE PE=3 SV=2 87 259 3.0E-07
sp|A1B5Y2|DAPE_PARDP Succinyl-diaminopimelate desuccinylase OS=Paracoccus denitrificans (strain Pd 1222) GN=dapE PE=3 SV=1 118 523 4.0E-07
sp|B2HY23|DAPE_ACIBC Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ACICU) GN=dapE PE=3 SV=1 106 259 4.0E-07
sp|A5WD56|DAPE_PSYWF Succinyl-diaminopimelate desuccinylase OS=Psychrobacter sp. (strain PRwf-1) GN=dapE PE=3 SV=1 116 217 4.0E-07
sp|Q1LNH3|DAPE_CUPMC Succinyl-diaminopimelate desuccinylase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dapE PE=3 SV=1 91 282 5.0E-07
sp|A1UUD2|DAPE_BARBK Succinyl-diaminopimelate desuccinylase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=dapE PE=3 SV=1 116 201 5.0E-07
sp|Q63T00|DAPE_BURPS Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain K96243) GN=dapE PE=3 SV=2 87 259 5.0E-07
sp|A3NAW2|DAPE_BURP6 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 668) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|A3NWP5|DAPE_BURP0 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1106a) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|B0VRY3|DAPE_ACIBS Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain SDF) GN=dapE PE=3 SV=1 106 259 5.0E-07
sp|Q3JR15|DAPE_BURP1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia pseudomallei (strain 1710b) GN=dapE PE=3 SV=2 87 259 5.0E-07
sp|A1V584|DAPE_BURMS Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain SAVP1) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|Q62JB1|DAPE_BURMA Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain ATCC 23344) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|A2SB58|DAPE_BURM9 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10229) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|A3MKV8|DAPE_BURM7 Succinyl-diaminopimelate desuccinylase OS=Burkholderia mallei (strain NCTC 10247) GN=dapE PE=3 SV=1 87 259 5.0E-07
sp|B0V4V8|DAPE_ACIBY Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AYE) GN=dapE PE=3 SV=1 106 259 5.0E-07
sp|B7I842|DAPE_ACIB5 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB0057) GN=dapE PE=3 SV=1 106 259 5.0E-07
sp|Q31G37|DAPE_THICR Succinyl-diaminopimelate desuccinylase OS=Thiomicrospira crunogena (strain XCL-2) GN=dapE PE=3 SV=1 116 275 5.0E-07
sp|A3M8H2|DAPE_ACIBT Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dapE PE=3 SV=2 106 259 5.0E-07
sp|B7GXA3|DAPE_ACIB3 Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baumannii (strain AB307-0294) GN=dapE PE=3 SV=1 106 259 6.0E-07
sp|Q5NYT7|DAPE_AROAE Succinyl-diaminopimelate desuccinylase OS=Aromatoleum aromaticum (strain EbN1) GN=dapE PE=3 SV=1 92 191 7.0E-07
sp|Q83DN2|DAPE_COXBU Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=dapE PE=3 SV=1 103 271 7.0E-07
sp|A9KC82|DAPE_COXBN Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=dapE PE=3 SV=1 103 271 7.0E-07
sp|B6J120|DAPE_COXB2 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuG_Q212) GN=dapE PE=3 SV=1 103 271 7.0E-07
sp|B6J929|DAPE_COXB1 Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain CbuK_Q154) GN=dapE PE=3 SV=1 103 271 7.0E-07
sp|Q6FE14|DAPE_ACIAD Succinyl-diaminopimelate desuccinylase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dapE PE=3 SV=1 114 290 8.0E-07
sp|A9NCE9|DAPE_COXBR Succinyl-diaminopimelate desuccinylase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=dapE PE=3 SV=1 104 271 8.0E-07
sp|A1ISU7|DAPE_NEIMA Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=dapE PE=3 SV=1 106 206 9.0E-07
sp|A9M0W6|DAPE_NEIM0 Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C (strain 053442) GN=dapE PE=3 SV=1 106 206 9.0E-07
sp|Q8XZK5|DAPE_RALSO Succinyl-diaminopimelate desuccinylase OS=Ralstonia solanacearum (strain GMI1000) GN=dapE PE=3 SV=2 114 526 9.0E-07
sp|B4RKY8|DAPE_NEIG2 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain NCCP11945) GN=dapE PE=3 SV=2 116 206 1.0E-06
sp|Q9JYL2|DAPE_NEIMB Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup B (strain MC58) GN=dapE PE=1 SV=1 116 206 1.0E-06
sp|Q5F812|DAPE_NEIG1 Succinyl-diaminopimelate desuccinylase OS=Neisseria gonorrhoeae (strain ATCC 700825 / FA 1090) GN=dapE PE=3 SV=1 116 206 1.0E-06
sp|A1KUW7|DAPE_NEIMF Succinyl-diaminopimelate desuccinylase OS=Neisseria meningitidis serogroup C / serotype 2a (strain ATCC 700532 / DSM 15464 / FAM18) GN=dapE PE=3 SV=1 116 206 1.0E-06
sp|A9CKC4|DAPE_AGRFC Succinyl-diaminopimelate desuccinylase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=dapE PE=3 SV=1 116 290 1.0E-06
sp|A1K719|DAPE_AZOSB Succinyl-diaminopimelate desuccinylase OS=Azoarcus sp. (strain BH72) GN=dapE PE=3 SV=1 96 259 1.0E-06
sp|Q28VJ1|DAPE_JANSC Succinyl-diaminopimelate desuccinylase OS=Jannaschia sp. (strain CCS1) GN=dapE PE=3 SV=1 87 208 1.0E-06
sp|A4YLC3|DAPE_BRASO Succinyl-diaminopimelate desuccinylase OS=Bradyrhizobium sp. (strain ORS278) GN=dapE PE=3 SV=1 116 193 2.0E-06
sp|Q0VQG3|DAPE_ALCBS Succinyl-diaminopimelate desuccinylase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=dapE PE=3 SV=1 115 402 2.0E-06
sp|Q0ASJ5|DAPE_MARMM Succinyl-diaminopimelate desuccinylase OS=Maricaulis maris (strain MCS10) GN=dapE PE=3 SV=1 103 207 2.0E-06
sp|A1VN92|DAPE_POLNA Succinyl-diaminopimelate desuccinylase OS=Polaromonas naphthalenivorans (strain CJ2) GN=dapE PE=3 SV=1 112 282 2.0E-06
sp|Q13F22|DAPE_RHOPS Succinyl-diaminopimelate desuccinylase OS=Rhodopseudomonas palustris (strain BisB5) GN=dapE PE=3 SV=1 116 201 2.0E-06
sp|B2T5K8|DAPE_BURPP Succinyl-diaminopimelate desuccinylase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dapE PE=3 SV=1 98 401 2.0E-06
sp|Q47FB0|DAPE_DECAR Succinyl-diaminopimelate desuccinylase OS=Dechloromonas aromatica (strain RCB) GN=dapE PE=3 SV=1 81 191 2.0E-06
sp|A1WEL1|DAPE_VEREI Succinyl-diaminopimelate desuccinylase OS=Verminephrobacter eiseniae (strain EF01-2) GN=dapE PE=3 SV=1 113 259 2.0E-06
sp|Q15TS8|DAPE_PSEA6 Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dapE PE=3 SV=1 117 282 3.0E-06
sp|Q058B2|DAPE_BUCCC Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Cinara cedri (strain Cc) GN=dapE PE=3 SV=1 91 268 3.0E-06
sp|A0K8F6|DAPE_BURCH Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain HI2424) GN=dapE PE=3 SV=1 87 259 3.0E-06
sp|Q1BHJ5|DAPE_BURCA Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain AU 1054) GN=dapE PE=3 SV=1 87 259 3.0E-06
sp|A1TQ19|DAPE_ACIAC Succinyl-diaminopimelate desuccinylase OS=Acidovorax citrulli (strain AAC00-1) GN=dapE PE=3 SV=1 116 259 3.0E-06
sp|Q39F31|DAPE_BURL3 Succinyl-diaminopimelate desuccinylase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dapE PE=3 SV=1 92 259 3.0E-06
sp|Q4FNF5|DAPE_PELUB Succinyl-diaminopimelate desuccinylase OS=Pelagibacter ubique (strain HTCC1062) GN=dapE PE=3 SV=1 117 271 3.0E-06
sp|Q0A7H5|DAPE_ALKEH Succinyl-diaminopimelate desuccinylase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dapE PE=3 SV=1 82 273 4.0E-06
sp|Q1MM75|DAPE_RHIL3 Succinyl-diaminopimelate desuccinylase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=dapE PE=3 SV=1 116 290 4.0E-06
sp|B5F0L0|DAPE_SALA4 Succinyl-diaminopimelate desuccinylase OS=Salmonella agona (strain SL483) GN=dapE PE=3 SV=1 104 259 4.0E-06
sp|Q492F7|DAPE_BLOPB Succinyl-diaminopimelate desuccinylase OS=Blochmannia pennsylvanicus (strain BPEN) GN=dapE PE=3 SV=1 116 273 4.0E-06
sp|Q2GHW1|DAPE_EHRCR Succinyl-diaminopimelate desuccinylase OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dapE PE=3 SV=1 87 191 4.0E-06
sp|Q5HC82|DAPE_EHRRW Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Welgevonden) GN=dapE PE=3 SV=1 103 191 4.0E-06
sp|Q5FFA0|DAPE_EHRRG Succinyl-diaminopimelate desuccinylase OS=Ehrlichia ruminantium (strain Gardel) GN=dapE PE=3 SV=1 103 191 5.0E-06
sp|A4WD51|DAPE_ENT38 Succinyl-diaminopimelate desuccinylase OS=Enterobacter sp. (strain 638) GN=dapE PE=3 SV=1 104 273 5.0E-06
sp|Q5AKA5|DUG1_CANAL Cys-Gly metallodipeptidase DUG1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=DUG1 PE=1 SV=1 40 190 5.0E-06
sp|B4ECP3|DAPE_BURCJ Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dapE PE=3 SV=1 87 259 5.0E-06
sp|Q4QP83|DAPE_HAEI8 Succinyl-diaminopimelate desuccinylase OS=Haemophilus influenzae (strain 86-028NP) GN=dapE PE=3 SV=1 114 274 5.0E-06
sp|Q12C18|DAPE_POLSJ Succinyl-diaminopimelate desuccinylase OS=Polaromonas sp. (strain JS666 / ATCC BAA-500) GN=dapE PE=3 SV=1 109 206 5.0E-06
sp|Q3IL20|DAPE_PSEHT Succinyl-diaminopimelate desuccinylase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=dapE PE=3 SV=1 107 206 5.0E-06
sp|A9AHS8|DAPE_BURM1 Succinyl-diaminopimelate desuccinylase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dapE PE=3 SV=1 97 259 5.0E-06
sp|Q2NS82|DAPE_SODGM Succinyl-diaminopimelate desuccinylase OS=Sodalis glossinidius (strain morsitans) GN=dapE PE=3 SV=1 104 280 5.0E-06
sp|Q55DP8|ACY1_DICDI Aminoacylase-1 OS=Dictyostelium discoideum GN=acy1 PE=2 SV=1 102 221 6.0E-06
sp|A6VMI0|DAPE_ACTSZ Succinyl-diaminopimelate desuccinylase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=dapE PE=3 SV=1 115 278 6.0E-06
sp|A4JF88|DAPE_BURVG Succinyl-diaminopimelate desuccinylase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dapE PE=3 SV=1 87 259 7.0E-06
sp|Q98D57|DAPE_RHILO Succinyl-diaminopimelate desuccinylase OS=Rhizobium loti (strain MAFF303099) GN=dapE PE=3 SV=1 108 201 7.0E-06
sp|B1JUG2|DAPE_BURCC Succinyl-diaminopimelate desuccinylase OS=Burkholderia cenocepacia (strain MC0-3) GN=dapE PE=3 SV=1 87 259 8.0E-06
sp|Q6D7N4|DAPE_PECAS Succinyl-diaminopimelate desuccinylase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=dapE PE=3 SV=1 104 259 8.0E-06
sp|Q7N3J4|DAPE_PHOLL Succinyl-diaminopimelate desuccinylase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dapE PE=3 SV=1 104 280 8.0E-06
sp|Q89AY1|DAPE_BUCBP Succinyl-diaminopimelate desuccinylase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=dapE PE=3 SV=1 91 278 1.0E-05
sp|A0KIB5|DAPE_AERHH Succinyl-diaminopimelate desuccinylase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dapE PE=3 SV=1 106 259 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0016787 hydrolase activity Yes
GO:0003824 catalytic activity No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093390
MYYKRRSIFYQLPLNRMLVRNHLANRNSKRFSTSLSWPSLQSKTITWLSEAIQVPTESWDAMGPVGEDPRWEVLA
PFHEYLEKAFPLVYSNLKVTKVNTYGIIYEWKGTSPELKPVLFAAHQDVVPVETSTVDEWNYPPFSGHFDGEKIW
GRGASDDKSGLIGVLVALETLISHGYQPTRSIVLASGFDEEVSGLRGAATLAPVLQDLYGKNGFAFVIDEGSGFG
KEYGTTFAMVGTAEKGYTDVEVKVASAGGHSSLPPDHTSIGILSAMLTHLESNPFKLEFSRDHPLYGSLQCLATH
ATNMPHDLRKLIRASTTSDDAMSKLTSTMSKDRSMKNLIGTTQAIDLISGGIKANALPEQAAAIVNHRISVTSSL
KATKDRDVQLLTGLASQFNLSFTAFGEVVAGGSEGSLTLGDPFHDGLEPAPITSTDAAPFQVLSGTIRATFNSHR
GLTGPDHIFVTPGTMSGNTDTRYYWDLAPSIFRYNHQNFGDVLIGVPKGIHTVNEYMEADSFMEIIEFFTMLILN
TDESTHL*
Coding >AgabiH97|093390
ATGTACTATAAAAGACGCTCGATTTTCTACCAGTTGCCCCTGAACCGCATGCTTGTCCGAAACCATCTCGCAAAT
CGAAATTCAAAGCGCTTCTCCACGTCCTTATCCTGGCCCTCGTTGCAGTCAAAGACGATCACCTGGCTAAGCGAA
GCCATCCAAGTCCCAACGGAATCCTGGGATGCGATGGGCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCA
CCCTTCCATGAATACCTTGAGAAGGCATTTCCTTTGGTGTATTCTAACCTCAAGGTGACCAAAGTTAACACGTAT
GGTATAATCTACGAGTGGAAGGGTACATCTCCCGAACTGAAACCTGTCCTATTCGCTGCCCATCAAGACGTCGTT
CCGGTGGAAACAAGCACGGTCGATGAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGCGAAAAAATCTGG
GGTCGGGGAGCATCCGATGATAAATCTGGCCTCATTGGGGTACTCGTTGCTCTCGAAACACTTATCTCTCATGGA
TATCAGCCAACTCGAAGCATTGTCCTTGCATCTGGTTTCGACGAAGAAGTCAGTGGACTGAGGGGTGCTGCTACT
TTGGCCCCTGTTCTTCAAGATCTCTACGGGAAAAATGGATTTGCCTTCGTGATTGATGAAGGATCTGGCTTCGGA
AAGGAATATGGCACTACTTTTGCGATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCT
AGCGCTGGCGGTCATTCCAGCTTGCCACCGGATCATACGTCAATCGGTATACTTTCAGCAATGTTAACACATTTG
GAGTCAAACCCTTTCAAGCTTGAATTTAGTCGGGACCATCCATTATATGGATCTTTACAGTGCCTTGCTACACAT
GCAACGAACATGCCACATGACCTTCGGAAGCTGATCAGAGCCTCGACAACTTCCGATGATGCTATGAGCAAGCTG
ACTAGCACAATGTCTAAGGATCGCTCGATGAAGAATTTGATTGGTACGACCCAGGCCATCGATTTGATCAGTGGA
GGCATCAAAGCAAATGCACTACCAGAACAAGCAGCAGCGATTGTCAACCATCGCATTTCTGTGACGAGCTCCCTT
AAAGCCACCAAAGACAGAGACGTCCAACTTCTAACGGGTTTAGCAAGCCAATTTAATCTCTCGTTTACTGCTTTC
GGTGAAGTTGTCGCGGGAGGCTCCGAAGGCAGCCTTACCCTTGGAGATCCTTTCCACGACGGACTAGAACCGGCT
CCGATAACGTCCACAGATGCCGCACCTTTCCAAGTGCTCTCCGGAACCATCAGAGCGACATTCAACTCACACCGT
GGTCTCACAGGCCCTGACCATATCTTTGTGACTCCAGGGACAATGTCAGGAAATACCGACACCCGTTATTATTGG
GACCTTGCACCCTCCATCTTCCGTTATAATCACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATT
CACACTGTCAACGAATATATGGAAGCCGACTCCTTCATGGAAATAATTGAATTTTTCACGATGCTCATTCTCAAC
ACTGACGAGTCTACACATTTGTAA
Transcript >AgabiH97|093390
ATGTACTATAAAAGACGCTCGATTTTCTACCAGTTGCCCCTGAACCGCATGCTTGTCCGAAACCATCTCGCAAAT
CGAAATTCAAAGCGCTTCTCCACGTCCTTATCCTGGCCCTCGTTGCAGTCAAAGACGATCACCTGGCTAAGCGAA
GCCATCCAAGTCCCAACGGAATCCTGGGATGCGATGGGCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCA
CCCTTCCATGAATACCTTGAGAAGGCATTTCCTTTGGTGTATTCTAACCTCAAGGTGACCAAAGTTAACACGTAT
GGTATAATCTACGAGTGGAAGGGTACATCTCCCGAACTGAAACCTGTCCTATTCGCTGCCCATCAAGACGTCGTT
CCGGTGGAAACAAGCACGGTCGATGAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGCGAAAAAATCTGG
GGTCGGGGAGCATCCGATGATAAATCTGGCCTCATTGGGGTACTCGTTGCTCTCGAAACACTTATCTCTCATGGA
TATCAGCCAACTCGAAGCATTGTCCTTGCATCTGGTTTCGACGAAGAAGTCAGTGGACTGAGGGGTGCTGCTACT
TTGGCCCCTGTTCTTCAAGATCTCTACGGGAAAAATGGATTTGCCTTCGTGATTGATGAAGGATCTGGCTTCGGA
AAGGAATATGGCACTACTTTTGCGATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCT
AGCGCTGGCGGTCATTCCAGCTTGCCACCGGATCATACGTCAATCGGTATACTTTCAGCAATGTTAACACATTTG
GAGTCAAACCCTTTCAAGCTTGAATTTAGTCGGGACCATCCATTATATGGATCTTTACAGTGCCTTGCTACACAT
GCAACGAACATGCCACATGACCTTCGGAAGCTGATCAGAGCCTCGACAACTTCCGATGATGCTATGAGCAAGCTG
ACTAGCACAATGTCTAAGGATCGCTCGATGAAGAATTTGATTGGTACGACCCAGGCCATCGATTTGATCAGTGGA
GGCATCAAAGCAAATGCACTACCAGAACAAGCAGCAGCGATTGTCAACCATCGCATTTCTGTGACGAGCTCCCTT
AAAGCCACCAAAGACAGAGACGTCCAACTTCTAACGGGTTTAGCAAGCCAATTTAATCTCTCGTTTACTGCTTTC
GGTGAAGTTGTCGCGGGAGGCTCCGAAGGCAGCCTTACCCTTGGAGATCCTTTCCACGACGGACTAGAACCGGCT
CCGATAACGTCCACAGATGCCGCACCTTTCCAAGTGCTCTCCGGAACCATCAGAGCGACATTCAACTCACACCGT
GGTCTCACAGGCCCTGACCATATCTTTGTGACTCCAGGGACAATGTCAGGAAATACCGACACCCGTTATTATTGG
GACCTTGCACCCTCCATCTTCCGTTATAATCACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATT
CACACTGTCAACGAATATATGGAAGCCGACTCCTTCATGGAAATAATTGAATTTTTCACGATGCTCATTCTCAAC
ACTGACGAGTCTACACATTTGTAA
Gene >AgabiH97|093390
ATGTACTATGTAAGAAGCTATTTCCTGGATTCTTCTTTTTGGTCTCATACTTTTACAACCATGCAAGAAAAGACG
CTCGATTTTCTACCAGTTGCCCCTGAACCGCATGCTTGTCCGAAACCATCTCGCAAATCGAAATTCAAAGCGCTT
CTCCACGTCCTTATCCTGGCCCTCGTTGCAGGTGCAATCGGAATAGCCGCTTTCCATGGAGGGACGTCGTGTGGA
AGGAAAAATTCGTCTACTGCTGAAACCTTTGATGGCACATGTGGTCAAGCAGATGTACTTTTCCCCCAAAGACAC
AGTCAACTATGGGCCAATTTGACTGCAACTTTCGGTTCGCGTGACTATCAGTCAAAGACGATCACCTGGCTAAGC
GAAGCCATCCAAGTCCCGTGAGTATTGGTGTAGTCTGGTCCATAAGAAATGAATCTAACATAGCATATTCAGAAC
GGAATCCTGGGATGCGATGGGCCCGGTTGGCGAGGATCCCAGGTGGGAAGTATTAGCACCCTTCCATGAATACCT
TGAGAAGGCATTTCCTTTGGTGTACGTTCATTCTGACTCCTAATTTGTACTTTTTGATCATCCGCTCCCAGGTAT
TCTAACCTCAAGGTGACCAAAGTTAACACGTATGGTATAATCTACGAGTGGAAGGGTACATCTCCCGAACTGAAA
CCTGTCCTATTCGCTGCCCATCAAGGTATGTCATAAAGACTGGGGGCTACGTTCTTATTGAACTCGAAAACCCAT
AGACGTCGTTCCGGTGGAAACAAGCACGGTCGATGAGTGGAATTATCCGCCCTTCTCTGGTCACTTCGATGGTAC
TATTAATTTTTATCGTGACTTGATGCAAAGTGGCTGATTTCCCATCTTCGCAGGCGAAAAAATCTGGGGTCGGGG
AGCATCCGATGATAAATCTGGCCTCATTGGGGTACTGTAAGTGGTTTAAAGTTCCACAATACCTCCGTCTATAAT
CTCGGCAGCGTTGCTCTCGAAACACTTATCTCTCATGGATATCAGCCAACTCGAAGCATTGTCCTTGCATCTGGT
TTCGACGAAGAAGTCAGTGGACTGAGGGTACGATAATTTTGGGTAGAAGCTCTTGGAGTTGAGTCGAATCCTGAT
GATTCACTAGGGTGCTGCTACTTTGGCCCCTGTTCTTCAAGATCTCTACGGGAAAAATGGATTTGCCTTCGTGAT
TGATGAAGGATGTGAGTTCAATCAAAGTCATCTTGACGGAAGTAGATACTGAGATATTGCGTAGCTGGCTTCGGA
AAGGAATATGGCACTACTTTTGCGATGGTAGGCACTGCGGAGAAGGGATATACCGATGTCGAAGTCAAGGTAGCT
AGCGCTGGCGGTCATTCCAGCTTGCCACCGGATCATACGGTACATCTCTCTCTCACCCTCGGTCGGCCGATGTCT
TGAGCTCAACCGTGCTTACAGTCAATCGGTATACTTTCAGCAATGTTAACACATTTGGAGTCAAACCCTTTCAAG
CTTGAATTTGTCGGTAAAGTCGATGTAAGCGATGAGCTGCTCGCTGACATGCTTTCTCTCAGAGTCGGGACCATC
CATTATATGGATCTTTACAGTGCCTTGCTACACATGCAACGAACATGCCACATGACCTTCGGAAGCTGATCAGAG
CCTCGACAACTTCCGATGATGCTATGAGCAAGCTGACTAGCACAATGTCTAAGGATCGCTCGATGAAGAATTTGA
TTGGTACGACCCAGGCCATCGATTTGATCAGTGGAGGCATCAAAGCAAATGCACTACCAGAACAAGCAGCAGCGA
TTGTCAACCATCGCATTTCTGTGACGAGGTTAGGGTCTTTCCACGATATACGAGAGGTTACTTATTGTTTGCCTG
TTGTTTGCAGCTCCCTTAAAGCCACCAAAGACAGAGACGTCCAACTTCTAACGGGTTTAGCAAGCCAATTTAATC
TCTCGTTTACTGCTTTCGGTGAAGTTGTCGCGGGAGGCTCCGAAGGCAGCCTTACCCTTGGAGATCCTTTCCACG
ACGGACTAGAACCGGCTCCGATAACGTCCACAGATGCCGCACCTTTCCAAGTGCTCTCCGGAACCATCAGAGCGA
CATTCAACTCACACCGTGGTCTCACAGGCCCTGACCATATCTTTGTGACTCCAGGGACAATGTCAGGAAATACCG
GTGAGTGGCGAATCATCTTCAAGGGATTGAGGCTGATACGAAGGAACATCAGACACCCGTTATTATTGGGACCTT
GCACCCTCCATCTTCCGTTATAATCACCAAAACTTCGGTGACGTGCTTATTGGAGTCCCGAAAGGCATTCACACT
GTCAACGAATGTCAGTATGCTTTCTAATTTGTCATTTATAAACGAACTTAAAGTCTCTCAGATATGGAAGCCGAC
TCCTTCATGGAAATAATTGAATTTTTCACGATGCTCATTCTCAACACTGACGAGTCTACACATTTGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail