Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093310
Gene name
Locationscaffold_6:1300288..1305150
Strand+
Gene length (bp)4862
Transcript length (bp)4290
Coding sequence length (bp)4290
Protein length (aa) 1430

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00620 RhoGAP RhoGAP domain 5.2E-31 1070 1219
PF00412 LIM LIM domain 1.9E-07 190 247
PF00412 LIM LIM domain 7.6E-11 253 308

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 186 641 8.0E-124
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 939 1279 6.0E-79
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 947 1259 2.0E-50
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 202 815 2.0E-48
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 184 345 1.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 186 641 8.0E-124
sp|O43052|RGA1_SCHPO Rho-type GTPase-activating protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga1 PE=1 SV=1 939 1279 6.0E-79
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 947 1259 2.0E-50
sp|P35688|LRG1_YEAST Rho-GTPase-activating protein LRG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=LRG1 PE=1 SV=3 202 815 2.0E-48
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 184 345 1.0E-23
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 184 348 1.0E-23
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 184 345 2.0E-23
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 184 345 3.0E-23
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 184 345 3.0E-23
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 79 343 9.0E-21
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 170 344 1.0E-18
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 186 345 3.0E-18
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 186 345 3.0E-18
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 186 347 7.0E-18
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 186 347 9.0E-18
sp|Q5TG30|RHG40_HUMAN Rho GTPase-activating protein 40 OS=Homo sapiens GN=ARHGAP40 PE=3 SV=3 981 1254 1.0E-17
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 190 344 2.0E-17
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 179 343 4.0E-17
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 190 344 1.0E-16
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 190 344 2.0E-16
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 184 325 2.0E-15
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 184 325 6.0E-15
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 190 325 7.0E-15
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 185 343 8.0E-15
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 184 325 1.0E-14
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 184 325 1.0E-14
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 184 325 1.0E-14
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 190 337 3.0E-14
sp|Q80Y19|RHGBA_MOUSE Rho GTPase-activating protein 11A OS=Mus musculus GN=Arhgap11a PE=1 SV=2 1069 1254 4.0E-14
sp|Q6P7E4|PDLI7_DANRE PDZ and LIM domain protein 7 OS=Danio rerio GN=pdlim7 PE=2 SV=1 115 343 4.0E-14
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 185 339 7.0E-14
sp|A9LS46|WTIP_XENLA Wilms tumor protein 1-interacting protein homolog OS=Xenopus laevis GN=wtip PE=2 SV=1 190 339 2.0E-13
sp|Q9JKS4|LDB3_MOUSE LIM domain-binding protein 3 OS=Mus musculus GN=Ldb3 PE=1 SV=1 182 342 2.0E-13
sp|O75112|LDB3_HUMAN LIM domain-binding protein 3 OS=Homo sapiens GN=LDB3 PE=1 SV=2 182 342 2.0E-13
sp|Q679P3|PDLI7_CHICK PDZ and LIM domain protein 7 OS=Gallus gallus GN=PDLIM7 PE=1 SV=1 147 343 3.0E-13
sp|Q6INU3|PDLI7_XENLA PDZ and LIM domain protein 7 OS=Xenopus laevis GN=pdlim7 PE=2 SV=1 155 343 3.0E-13
sp|E9Q6X9|RHG40_MOUSE Rho GTPase-activating protein 40 OS=Mus musculus GN=Arhgap40 PE=3 SV=1 1085 1254 5.0E-13
sp|Q9Y3M8|STA13_HUMAN StAR-related lipid transfer protein 13 OS=Homo sapiens GN=STARD13 PE=1 SV=2 979 1254 5.0E-13
sp|Q6P4F7|RHGBA_HUMAN Rho GTPase-activating protein 11A OS=Homo sapiens GN=ARHGAP11A PE=1 SV=2 1069 1254 6.0E-13
sp|Q3TJD7|PDLI7_MOUSE PDZ and LIM domain protein 7 OS=Mus musculus GN=Pdlim7 PE=1 SV=1 189 343 1.0E-12
sp|P34288|PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans GN=pac-1 PE=1 SV=4 1069 1218 1.0E-12
sp|Q9Z1Z9|PDLI7_RAT PDZ and LIM domain protein 7 OS=Rattus norvegicus GN=Pdlim7 PE=1 SV=1 189 343 1.0E-12
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 185 310 2.0E-12
sp|A8DZE6|WTIP_DANRE Wilms tumor protein 1-interacting protein homolog OS=Danio rerio GN=wtip PE=3 SV=1 190 339 2.0E-12
sp|Q9NR12|PDLI7_HUMAN PDZ and LIM domain protein 7 OS=Homo sapiens GN=PDLIM7 PE=1 SV=1 189 343 2.0E-12
sp|Q54FF4|GACL_DICDI Rho GTPase-activating protein gacL OS=Dictyostelium discoideum GN=gacL PE=2 SV=1 1037 1225 4.0E-12
sp|Q71M21|RH21B_XENLA Rho GTPase-activating protein 21-B OS=Xenopus laevis GN=arhgap21-b PE=2 SV=1 1020 1247 4.0E-12
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 90 344 5.0E-12
sp|Q8N392|RHG18_HUMAN Rho GTPase-activating protein 18 OS=Homo sapiens GN=ARHGAP18 PE=1 SV=3 1066 1260 5.0E-12
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 190 349 8.0E-12
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 185 340 9.0E-12
sp|Q7TQJ8|WTIP_MOUSE Wilms tumor protein 1-interacting protein OS=Mus musculus GN=Wtip PE=1 SV=1 190 339 1.0E-11
sp|Q8C170|MYO9A_MOUSE Unconventional myosin-IXa OS=Mus musculus GN=Myo9a PE=1 SV=2 1069 1218 1.0E-11
sp|Q9U3F4|ZYX_CAEEL Zyxin OS=Caenorhabditis elegans GN=zyx-1 PE=1 SV=1 190 341 1.0E-11
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 190 341 2.0E-11
sp|Q3SX40|PDLI7_BOVIN PDZ and LIM domain protein 7 OS=Bos taurus GN=PDLIM7 PE=2 SV=1 189 343 2.0E-11
sp|Q8K0Q5|RHG18_MOUSE Rho GTPase-activating protein 18 OS=Mus musculus GN=Arhgap18 PE=1 SV=1 1042 1254 2.0E-11
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 189 307 2.0E-11
sp|B2RTY4|MYO9A_HUMAN Unconventional myosin-IXa OS=Homo sapiens GN=MYO9A PE=1 SV=2 1069 1218 2.0E-11
sp|Q9VY77|AJUBA_DROME LIM domain-containing protein jub OS=Drosophila melanogaster GN=jub PE=1 SV=3 190 345 2.0E-11
sp|A6NIX2|WTIP_HUMAN Wilms tumor protein 1-interacting protein OS=Homo sapiens GN=WTIP PE=1 SV=3 190 339 2.0E-11
sp|Q9Z1N3|MYO9A_RAT Unconventional myosin-IXa OS=Rattus norvegicus GN=Myo9a PE=1 SV=1 1069 1218 3.0E-11
sp|Q96IF1|AJUBA_HUMAN LIM domain-containing protein ajuba OS=Homo sapiens GN=AJUBA PE=1 SV=1 189 342 3.0E-11
sp|Q6DFG0|RH21A_XENLA Rho GTPase-activating protein 21-A OS=Xenopus laevis GN=arhgap21-a PE=2 SV=1 1020 1247 3.0E-11
sp|Q91XC0|AJUBA_MOUSE LIM domain-containing protein ajuba OS=Mus musculus GN=Ajuba PE=1 SV=1 189 342 4.0E-11
sp|A2RUV4|RHG21_XENTR Rho GTPase-activating protein 21 OS=Xenopus tropicalis GN=arhgap21 PE=2 SV=1 1020 1247 4.0E-11
sp|Q5U2Z2|AJUBA_RAT LIM domain-containing protein ajuba OS=Rattus norvegicus GN=Ajuba PE=1 SV=1 189 342 4.0E-11
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 185 340 5.0E-11
sp|E1BKA3|AJUBA_BOVIN LIM domain-containing protein ajuba OS=Bos taurus GN=AJUBA PE=3 SV=1 189 339 5.0E-11
sp|O74360|RGA4_SCHPO Probable Rho-type GTPase-activating protein 4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rga4 PE=1 SV=2 1067 1218 7.0E-11
sp|Q6ZUM4|RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens GN=ARHGAP27 PE=1 SV=3 1034 1218 7.0E-11
sp|Q923Q2|STA13_MOUSE StAR-related lipid transfer protein 13 OS=Mus musculus GN=Stard13 PE=1 SV=5 979 1275 7.0E-11
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 185 301 8.0E-11
sp|O43182|RHG06_HUMAN Rho GTPase-activating protein 6 OS=Homo sapiens GN=ARHGAP6 PE=1 SV=3 1068 1268 8.0E-11
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 190 301 9.0E-11
sp|Q03070|CHIO_RAT Beta-chimaerin OS=Rattus norvegicus GN=Chn2 PE=2 SV=1 1070 1247 9.0E-11
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 92 344 1.0E-10
sp|O54834|RHG06_MOUSE Rho GTPase-activating protein 6 OS=Mus musculus GN=Arhgap6 PE=1 SV=3 1068 1253 1.0E-10
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 172 343 1.0E-10
sp|A1ZA47|ZASP_DROME PDZ and LIM domain protein Zasp OS=Drosophila melanogaster GN=Zasp52 PE=1 SV=2 189 304 2.0E-10
sp|P20154|LIN11_CAEEL Protein lin-11 OS=Caenorhabditis elegans GN=lin-11 PE=1 SV=2 152 312 2.0E-10
sp|Q5ZMM3|RHG15_CHICK Rho GTPase-activating protein 15 OS=Gallus gallus GN=ARHGAP15 PE=2 SV=1 1039 1218 2.0E-10
sp|Q3KRB8|RHGBB_HUMAN Rho GTPase-activating protein 11B OS=Homo sapiens GN=ARHGAP11B PE=2 SV=1 1069 1218 2.0E-10
sp|Q55BI0|Y6787_DICDI LIM domain-containing protein DDB_G0271356 OS=Dictyostelium discoideum GN=DDB_G0271356 PE=3 SV=1 190 342 2.0E-10
sp|Q811P8|RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus GN=Arhgap32 PE=1 SV=2 920 1220 2.0E-10
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 189 305 2.0E-10
sp|Q80XD1|CHIO_MOUSE Beta-chimaerin OS=Mus musculus GN=Chn2 PE=1 SV=2 1070 1247 3.0E-10
sp|A7KAX9|RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens GN=ARHGAP32 PE=1 SV=1 921 1220 3.0E-10
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 172 343 3.0E-10
sp|Q6DFV3|RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus GN=Arhgap21 PE=1 SV=1 1020 1247 3.0E-10
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 187 342 3.0E-10
sp|Q54NW4|LIMB_DICDI LIM domain-containing protein B OS=Dictyostelium discoideum GN=limB PE=2 SV=1 187 327 4.0E-10
sp|Q5T5U3|RHG21_HUMAN Rho GTPase-activating protein 21 OS=Homo sapiens GN=ARHGAP21 PE=1 SV=1 1020 1247 4.0E-10
sp|G5E5X0|LIMD1_BOVIN LIM domain-containing protein 1 OS=Bos taurus GN=LIMD1 PE=3 SV=1 189 339 4.0E-10
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 92 344 4.0E-10
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 184 301 5.0E-10
sp|O60711|LPXN_HUMAN Leupaxin OS=Homo sapiens GN=LPXN PE=1 SV=1 185 320 5.0E-10
sp|P97447|FHL1_MOUSE Four and a half LIM domains protein 1 OS=Mus musculus GN=Fhl1 PE=1 SV=3 187 320 6.0E-10
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 185 341 6.0E-10
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 185 320 6.0E-10
sp|Q9UGP4|LIMD1_HUMAN LIM domain-containing protein 1 OS=Homo sapiens GN=LIMD1 PE=1 SV=1 189 358 6.0E-10
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 187 342 6.0E-10
sp|Q2TCH4|TGFI1_XENLA Transforming growth factor beta-1-induced transcript 1 protein OS=Xenopus laevis GN=tgfb1i1 PE=1 SV=2 185 310 1.0E-09
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 190 282 1.0E-09
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 185 282 1.0E-09
sp|Q3MHZ4|TGFI1_BOVIN Transforming growth factor beta-1-induced transcript 1 protein OS=Bos taurus GN=TGFB1I1 PE=2 SV=2 190 325 1.0E-09
sp|O43294|TGFI1_HUMAN Transforming growth factor beta-1-induced transcript 1 protein OS=Homo sapiens GN=TGFB1I1 PE=1 SV=2 190 325 1.0E-09
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 184 310 1.0E-09
sp|Q8K4G5|ABLM1_MOUSE Actin-binding LIM protein 1 OS=Mus musculus GN=Ablim1 PE=1 SV=1 186 293 1.0E-09
sp|Q9WUH4|FHL1_RAT Four and a half LIM domains protein 1 OS=Rattus norvegicus GN=Fhl1 PE=2 SV=1 187 320 1.0E-09
sp|A4IF90|RHG15_BOVIN Rho GTPase-activating protein 15 OS=Bos taurus GN=ARHGAP15 PE=2 SV=1 1039 1219 1.0E-09
sp|B5DEH0|LIMD1_RAT LIM domain-containing protein 1 OS=Rattus norvegicus GN=Limd1 PE=1 SV=1 190 339 1.0E-09
sp|Q62219|TGFI1_MOUSE Transforming growth factor beta-1-induced transcript 1 protein OS=Mus musculus GN=Tgfb1i1 PE=1 SV=2 190 325 2.0E-09
sp|Q99PD6|TGFI1_RAT Transforming growth factor beta-1-induced transcript 1 protein OS=Rattus norvegicus GN=Tgfb1i1 PE=1 SV=2 190 325 2.0E-09
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 252 345 2.0E-09
sp|Q9QXD8|LIMD1_MOUSE LIM domain-containing protein 1 OS=Mus musculus GN=Limd1 PE=1 SV=2 189 339 2.0E-09
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 189 311 2.0E-09
sp|Q63744|RHG07_RAT Rho GTPase-activating protein 7 OS=Rattus norvegicus GN=Dlc1 PE=1 SV=3 1025 1217 2.0E-09
sp|A6X8Z5|RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus GN=Arhgap31 PE=1 SV=1 1051 1247 2.0E-09
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 185 320 2.0E-09
sp|Q9R0Z9|RHG07_MOUSE Rho GTPase-activating protein 7 OS=Mus musculus GN=Dlc1 PE=1 SV=2 1025 1217 2.0E-09
sp|Q6Y5D8|RHG10_MOUSE Rho GTPase-activating protein 10 OS=Mus musculus GN=Arhgap10 PE=1 SV=2 1071 1247 3.0E-09
sp|Q62523|ZYX_MOUSE Zyxin OS=Mus musculus GN=Zyx PE=1 SV=2 189 336 3.0E-09
sp|P52757|CHIO_HUMAN Beta-chimaerin OS=Homo sapiens GN=CHN2 PE=1 SV=2 1070 1247 3.0E-09
sp|Q53QZ3|RHG15_HUMAN Rho GTPase-activating protein 15 OS=Homo sapiens GN=ARHGAP15 PE=1 SV=2 1039 1219 3.0E-09
sp|A1A4S6|RHG10_HUMAN Rho GTPase-activating protein 10 OS=Homo sapiens GN=ARHGAP10 PE=1 SV=1 1071 1250 3.0E-09
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 252 342 4.0E-09
sp|Q69ZH9|RHG23_MOUSE Rho GTPase-activating protein 23 OS=Mus musculus GN=Arhgap23 PE=1 SV=2 1068 1247 4.0E-09
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 185 320 4.0E-09
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 185 320 4.0E-09
sp|O14559|RHG33_HUMAN Rho GTPase-activating protein 33 OS=Homo sapiens GN=ARHGAP33 PE=1 SV=2 1087 1247 4.0E-09
sp|Q09476|PXL1_CAEEL Paxillin homolog 1 OS=Caenorhabditis elegans GN=pxl-1 PE=2 SV=2 187 356 5.0E-09
sp|P53668|LIMK1_MOUSE LIM domain kinase 1 OS=Mus musculus GN=Limk1 PE=1 SV=1 252 342 5.0E-09
sp|Q9P227|RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens GN=ARHGAP23 PE=1 SV=2 1068 1247 5.0E-09
sp|A7E300|RHG07_BOVIN Rho GTPase-activating protein 7 OS=Bos taurus GN=DLC1 PE=2 SV=1 1025 1217 5.0E-09
sp|Q9H0H5|RGAP1_HUMAN Rac GTPase-activating protein 1 OS=Homo sapiens GN=RACGAP1 PE=1 SV=1 1062 1254 5.0E-09
sp|O14639|ABLM1_HUMAN Actin-binding LIM protein 1 OS=Homo sapiens GN=ABLIM1 PE=1 SV=3 187 293 6.0E-09
sp|P53667|LIMK1_HUMAN LIM domain kinase 1 OS=Homo sapiens GN=LIMK1 PE=1 SV=3 252 342 7.0E-09
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 172 343 7.0E-09
sp|Q9QY06|MYO9B_MOUSE Unconventional myosin-IXb OS=Mus musculus GN=Myo9b PE=1 SV=2 1069 1218 7.0E-09
sp|P49024|PAXI_CHICK Paxillin OS=Gallus gallus GN=PXN PE=1 SV=1 190 282 8.0E-09
sp|A2AB59|RHG27_MOUSE Rho GTPase-activating protein 27 OS=Mus musculus GN=Arhgap27 PE=1 SV=1 1039 1218 8.0E-09
sp|Q8VI36|PAXI_MOUSE Paxillin OS=Mus musculus GN=Pxn PE=1 SV=1 190 310 9.0E-09
sp|Q8MML5|PAXB_DICDI Paxillin-B OS=Dictyostelium discoideum GN=paxB PE=2 SV=1 190 310 9.0E-09
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 184 301 9.0E-09
sp|Q8IR79|LIMK1_DROME LIM domain kinase 1 OS=Drosophila melanogaster GN=LIMK1 PE=1 SV=1 201 308 9.0E-09
sp|Q96QB1|RHG07_HUMAN Rho GTPase-activating protein 7 OS=Homo sapiens GN=DLC1 PE=1 SV=4 1025 1217 9.0E-09
sp|P49023|PAXI_HUMAN Paxillin OS=Homo sapiens GN=PXN PE=1 SV=3 190 282 1.0E-08
sp|Q8QFP8|LIMK1_CHICK LIM domain kinase 1 OS=Gallus gallus GN=LIMK1 PE=1 SV=1 252 341 1.0E-08
sp|O42565|LIMK1_XENLA LIM domain kinase 1 OS=Xenopus laevis GN=limk1 PE=2 SV=1 190 301 1.0E-08
sp|Q6TLK4|RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus GN=Arhgap27 PE=1 SV=1 1039 1218 1.0E-08
sp|B9VTT2|RHG07_CANLF Rho GTPase-activating protein 7 OS=Canis lupus familiaris GN=DLC1 PE=2 SV=1 1025 1217 1.0E-08
sp|P53407|ISL2B_DANRE Insulin gene enhancer protein isl-2b OS=Danio rerio GN=isl2b PE=2 SV=1 169 301 1.0E-08
sp|A6NI28|RHG42_HUMAN Rho GTPase-activating protein 42 OS=Homo sapiens GN=ARHGAP42 PE=1 SV=3 1071 1247 1.0E-08
sp|Q13459|MYO9B_HUMAN Unconventional myosin-IXb OS=Homo sapiens GN=MYO9B PE=1 SV=3 1069 1218 1.0E-08
sp|Q63358|MYO9B_RAT Unconventional myosin-IXb OS=Rattus norvegicus GN=Myo9b PE=1 SV=1 1069 1218 1.0E-08
sp|Q80YF9|RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus GN=Arhgap33 PE=1 SV=1 1087 1277 1.0E-08
sp|Q3UIA2|RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus GN=Arhgap17 PE=1 SV=1 1073 1253 1.0E-08
sp|Q99N37|RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus GN=Arhgap17 PE=1 SV=1 1073 1253 1.0E-08
sp|Q5R7I1|PAXI_PONAB Paxillin OS=Pongo abelii GN=PXN PE=2 SV=1 190 282 2.0E-08
sp|Q66H76|PAXI_RAT Paxillin OS=Rattus norvegicus GN=Pxn PE=1 SV=1 190 282 2.0E-08
sp|P53669|LIMK1_RAT LIM domain kinase 1 OS=Rattus norvegicus GN=Limk1 PE=1 SV=1 189 311 2.0E-08
sp|Q91Z67|SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus GN=Srgap2 PE=1 SV=2 1058 1246 2.0E-08
sp|Q6GPD0|RHG32_XENLA Rho GTPase-activating protein 32 OS=Xenopus laevis GN=arhgap32 PE=2 SV=1 1087 1220 2.0E-08
sp|Q8WUP2|FBLI1_HUMAN Filamin-binding LIM protein 1 OS=Homo sapiens GN=FBLIM1 PE=1 SV=2 202 339 2.0E-08
sp|Q71FD7|FBLI1_MOUSE Filamin-binding LIM protein 1 OS=Mus musculus GN=Fblim1 PE=1 SV=2 185 339 2.0E-08
sp|Q96A47|ISL2_HUMAN Insulin gene enhancer protein ISL-2 OS=Homo sapiens GN=ISL2 PE=1 SV=1 186 315 2.0E-08
sp|Q04584|ZYX_CHICK Zyxin OS=Gallus gallus GN=ZYX PE=1 SV=1 187 339 2.0E-08
sp|Q54SL6|GACQ_DICDI Rho GTPase-activating protein gacQ OS=Dictyostelium discoideum GN=gacQ PE=3 SV=1 1040 1253 2.0E-08
sp|Q9VTU3|RG68F_DROME Rho GTPase-activating protein 68F OS=Drosophila melanogaster GN=RhoGAP68F PE=1 SV=1 1085 1249 2.0E-08
sp|P50458|LHX2_HUMAN LIM/homeobox protein Lhx2 OS=Homo sapiens GN=LHX2 PE=2 SV=2 161 305 3.0E-08
sp|Q9Z0S2|LHX2_MOUSE LIM/homeobox protein Lhx2 OS=Mus musculus GN=Lhx2 PE=1 SV=1 161 305 3.0E-08
sp|P53409|ISL3_ONCTS Insulin gene enhancer protein ISL-3 OS=Oncorhynchus tshawytscha GN=isl3 PE=2 SV=1 169 315 3.0E-08
sp|D4A208|SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus GN=Srgap2 PE=1 SV=1 1058 1246 3.0E-08
sp|Q8BL80|RHG22_MOUSE Rho GTPase-activating protein 22 OS=Mus musculus GN=Arhgap22 PE=1 SV=2 1026 1225 3.0E-08
sp|Q1JQB5|FBLI1_BOVIN Filamin-binding LIM protein 1 OS=Bos taurus GN=FBLIM1 PE=2 SV=1 202 339 3.0E-08
sp|Q7Z5H3|RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens GN=ARHGAP22 PE=1 SV=1 1042 1251 3.0E-08
sp|B2RQE8|RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus GN=Arhgap42 PE=1 SV=1 1071 1247 3.0E-08
sp|Q9R1R0|LHX6_MOUSE LIM/homeobox protein Lhx6 OS=Mus musculus GN=Lhx6 PE=1 SV=2 252 341 3.0E-08
sp|Q68EM7|RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens GN=ARHGAP17 PE=1 SV=1 1039 1253 3.0E-08
sp|Q9N261|LPXN_RABIT Leupaxin OS=Oryctolagus cuniculus GN=LPXN PE=2 SV=1 185 320 4.0E-08
sp|Q8CI51|PDLI5_MOUSE PDZ and LIM domain protein 5 OS=Mus musculus GN=Pdlim5 PE=1 SV=4 190 282 4.0E-08
sp|Q62920|PDLI5_RAT PDZ and LIM domain protein 5 OS=Rattus norvegicus GN=Pdlim5 PE=1 SV=2 190 282 4.0E-08
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 170 354 4.0E-08
sp|Q96HC4|PDLI5_HUMAN PDZ and LIM domain protein 5 OS=Homo sapiens GN=PDLIM5 PE=1 SV=5 190 282 4.0E-08
sp|Q5REN1|FBLI1_PONAB Filamin-binding LIM protein 1 OS=Pongo abelii GN=FBLIM1 PE=2 SV=1 202 341 4.0E-08
sp|Q1LWV4|LHX9_DANRE LIM/homeobox protein Lhx9 OS=Danio rerio GN=lhx9 PE=2 SV=1 134 307 4.0E-08
sp|Q5SSM3|RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus GN=Arhgap44 PE=1 SV=1 1073 1253 4.0E-08
sp|P36198|LHX2_RAT LIM/homeobox protein Lhx2 OS=Rattus norvegicus GN=Lhx2 PE=2 SV=1 162 305 4.0E-08
sp|P37137|LHX5_XENLA LIM/homeobox protein Lhx5 OS=Xenopus laevis GN=lhx5 PE=1 SV=2 190 319 4.0E-08
sp|Q6ZM89|RH42A_DANRE Rho GTPase-activating protein 42 OS=Danio rerio GN=arhgap42a PE=2 SV=3 1071 1247 5.0E-08
sp|Q9CXV0|ISL2_MOUSE Insulin gene enhancer protein ISL-2 OS=Mus musculus GN=Isl2 PE=1 SV=2 186 315 5.0E-08
sp|Q8K031|STAR8_MOUSE StAR-related lipid transfer protein 8 OS=Mus musculus GN=Stard8 PE=1 SV=2 1055 1254 6.0E-08
sp|Q8BL65|ABLM2_MOUSE Actin-binding LIM protein 2 OS=Mus musculus GN=Ablim2 PE=1 SV=1 190 354 7.0E-08
sp|F1LQX4|RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus GN=Arhgap44 PE=1 SV=2 1073 1253 7.0E-08
sp|Q15942|ZYX_HUMAN Zyxin OS=Homo sapiens GN=ZYX PE=1 SV=1 190 339 7.0E-08
sp|Q08DP6|RHG10_BOVIN Rho GTPase-activating protein 10 OS=Bos taurus GN=ARHGAP10 PE=2 SV=1 1071 1250 8.0E-08
sp|Q8BN58|RHG28_MOUSE Rho GTPase-activating protein 28 OS=Mus musculus GN=Arhgap28 PE=1 SV=1 1010 1254 8.0E-08
sp|Q9H2C1|LHX5_HUMAN LIM/homeobox protein Lhx5 OS=Homo sapiens GN=LHX5 PE=2 SV=1 190 318 8.0E-08
sp|Q7Z3G6|PRIC2_HUMAN Prickle-like protein 2 OS=Homo sapiens GN=PRICKLE2 PE=1 SV=2 176 320 9.0E-08
sp|Q80W90|LHX9_RAT LIM/homeobox protein Lhx9 OS=Rattus norvegicus GN=Lhx9 PE=2 SV=1 142 307 9.0E-08
sp|Q6H8Q1|ABLM2_HUMAN Actin-binding LIM protein 2 OS=Homo sapiens GN=ABLIM2 PE=1 SV=2 190 354 1.0E-07
sp|P53405|ISL1_DANRE Insulin gene enhancer protein isl-1 OS=Danio rerio GN=isl1 PE=2 SV=1 188 315 1.0E-07
sp|P50480|ISL2_RAT Insulin gene enhancer protein ISL-2 OS=Rattus norvegicus GN=Isl2 PE=1 SV=1 186 315 1.0E-07
sp|Q9UPM6|LHX6_HUMAN LIM/homeobox protein Lhx6 OS=Homo sapiens GN=LHX6 PE=1 SV=2 252 341 1.0E-07
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 253 351 1.0E-07
sp|P0CAX5|OPHN1_RAT Oligophrenin-1 OS=Rattus norvegicus GN=Ophn1 PE=1 SV=1 1072 1252 1.0E-07
sp|Q9NQ69|LHX9_HUMAN LIM/homeobox protein Lhx9 OS=Homo sapiens GN=LHX9 PE=1 SV=3 142 307 1.0E-07
sp|Q811M1|RHG15_MOUSE Rho GTPase-activating protein 15 OS=Mus musculus GN=Arhgap15 PE=1 SV=1 1039 1219 1.0E-07
sp|P61376|LHX5_RAT LIM/homeobox protein Lhx5 OS=Rattus norvegicus GN=Lhx5 PE=2 SV=1 190 318 1.0E-07
sp|P61375|LHX5_MOUSE LIM/homeobox protein Lhx5 OS=Mus musculus GN=Lhx5 PE=2 SV=1 190 318 1.0E-07
sp|P61374|ISL1_RAT Insulin gene enhancer protein ISL-1 OS=Rattus norvegicus GN=Isl1 PE=2 SV=1 188 301 1.0E-07
sp|P61372|ISL1_MOUSE Insulin gene enhancer protein ISL-1 OS=Mus musculus GN=Isl1 PE=1 SV=1 188 301 1.0E-07
sp|P61373|ISL1_MESAU Insulin gene enhancer protein ISL-1 OS=Mesocricetus auratus GN=ISL1 PE=2 SV=1 188 301 1.0E-07
sp|P61371|ISL1_HUMAN Insulin gene enhancer protein ISL-1 OS=Homo sapiens GN=ISL1 PE=1 SV=1 188 301 1.0E-07
sp|Q54WY8|GACN_DICDI Rho GTPase-activating protein gacN OS=Dictyostelium discoideum GN=gacN PE=3 SV=1 1069 1218 1.0E-07
sp|Q9WVM1|RGAP1_MOUSE Rac GTPase-activating protein 1 OS=Mus musculus GN=Racgap1 PE=1 SV=1 1062 1254 1.0E-07
sp|P46941|TG325_CAEEL WW domain-containing protein tag-325 OS=Caenorhabditis elegans GN=tag-325 PE=3 SV=1 1042 1217 1.0E-07
sp|Q06BR1|LIMD1_XENLA LIM domain-containing protein 1 OS=Xenopus laevis GN=limd1 PE=1 SV=1 189 340 1.0E-07
sp|B7ZUL2|LIMD1_XENTR LIM domain-containing protein 1 OS=Xenopus tropicalis GN=limd1 PE=2 SV=1 189 341 1.0E-07
sp|Q5ZMW5|RHG26_CHICK Rho GTPase-activating protein 26 OS=Gallus gallus GN=ARHGAP26 PE=1 SV=2 1071 1247 2.0E-07
sp|Q17R89|RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens GN=ARHGAP44 PE=1 SV=1 1073 1253 2.0E-07
sp|Q80Y24|PRIC2_MOUSE Prickle-like protein 2 OS=Mus musculus GN=Prickle2 PE=1 SV=3 176 320 2.0E-07
sp|Q7YQL5|OPHN1_PONPY Oligophrenin-1 OS=Pongo pygmaeus GN=OPHN1 PE=2 SV=1 1072 1252 2.0E-07
sp|Q7YQL6|OPHN1_PANTR Oligophrenin-1 OS=Pan troglodytes GN=OPHN1 PE=2 SV=1 1072 1252 2.0E-07
sp|O60890|OPHN1_HUMAN Oligophrenin-1 OS=Homo sapiens GN=OPHN1 PE=1 SV=1 1072 1252 2.0E-07
sp|Q6AYC5|RHG15_RAT Rho GTPase-activating protein 15 OS=Rattus norvegicus GN=Arhgap15 PE=1 SV=1 1039 1219 2.0E-07
sp|Q69ZX8|ABLM3_MOUSE Actin-binding LIM protein 3 OS=Mus musculus GN=Ablim3 PE=1 SV=2 185 340 2.0E-07
sp|P50211|ISL1_CHICK Insulin gene enhancer protein ISL-1 OS=Gallus gallus GN=ISL1 PE=2 SV=1 188 301 2.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 250 341 2.0E-07
sp|P53670|LIMK2_RAT LIM domain kinase 2 OS=Rattus norvegicus GN=Limk2 PE=2 SV=1 190 313 2.0E-07
sp|Q7Z4I7|LIMS2_HUMAN LIM and senescent cell antigen-like-containing domain protein 2 OS=Homo sapiens GN=LIMS2 PE=1 SV=1 190 305 3.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 190 312 3.0E-07
sp|P53666|LIMK2_CHICK LIM domain kinase 2 OS=Gallus gallus GN=LIMK2 PE=2 SV=1 190 326 3.0E-07
sp|A0JNI8|LHX9_BOVIN LIM/homeobox protein Lhx9 OS=Bos taurus GN=LHX9 PE=2 SV=2 142 307 3.0E-07
sp|Q2M1Z3|RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens GN=ARHGAP31 PE=1 SV=2 1051 1247 3.0E-07
sp|Q5F464|LPP_CHICK Lipoma-preferred partner homolog OS=Gallus gallus GN=LPP PE=2 SV=1 190 339 3.0E-07
sp|O94929|ABLM3_HUMAN Actin-binding LIM protein 3 OS=Homo sapiens GN=ABLIM3 PE=1 SV=3 185 340 3.0E-07
sp|Q6DE55|HMHA1_XENLA Minor histocompatibility protein HA-1 OS=Xenopus laevis GN=hmha1 PE=2 SV=1 1063 1223 3.0E-07
sp|Q92502|STAR8_HUMAN StAR-related lipid transfer protein 8 OS=Homo sapiens GN=STARD8 PE=1 SV=2 1020 1217 3.0E-07
sp|Q54FG5|GACJJ_DICDI Rho GTPase-activating protein gacJJ OS=Dictyostelium discoideum GN=gacJJ PE=3 SV=1 1068 1278 3.0E-07
sp|Q9WUH2|LHX9_MOUSE LIM/homeobox protein Lhx9 OS=Mus musculus GN=Lhx9 PE=1 SV=3 142 307 3.0E-07
sp|O54785|LIMK2_MOUSE LIM domain kinase 2 OS=Mus musculus GN=Limk2 PE=1 SV=2 190 313 3.0E-07
sp|Q99JW4|LIMS1_MOUSE LIM and senescent cell antigen-like-containing domain protein 1 OS=Mus musculus GN=Lims1 PE=1 SV=3 190 301 4.0E-07
sp|P48059|LIMS1_HUMAN LIM and senescent cell antigen-like-containing domain protein 1 OS=Homo sapiens GN=LIMS1 PE=1 SV=4 190 301 4.0E-07
sp|Q2KJ33|LIMS2_BOVIN LIM and senescent cell antigen-like-containing domain protein 2 OS=Bos taurus GN=LIMS2 PE=2 SV=2 190 305 4.0E-07
sp|P53406|ISL2A_DANRE Insulin gene enhancer protein isl-2a OS=Danio rerio GN=isl2a PE=2 SV=1 190 301 4.0E-07
sp|Q5U4T3|RHG26_XENLA Rho GTPase-activating protein 26 OS=Xenopus laevis GN=arhgap26 PE=2 SV=1 1071 1250 4.0E-07
sp|Q99J31|OPHN1_MOUSE Oligophrenin-1 OS=Mus musculus GN=Ophn1 PE=1 SV=1 1072 1252 4.0E-07
sp|A2I8Z7|LHX9_ASTFA LIM/homeobox protein Lhx9 OS=Astyanax fasciatus GN=lhx9 PE=2 SV=1 190 307 4.0E-07
sp|P30337|CHIN_RAT N-chimaerin OS=Rattus norvegicus GN=Chn1 PE=1 SV=2 1031 1247 4.0E-07
sp|P15882|CHIN_HUMAN N-chimaerin OS=Homo sapiens GN=CHN1 PE=1 SV=3 1031 1219 4.0E-07
sp|Q7Z6I6|RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens GN=ARHGAP30 PE=1 SV=3 1031 1220 5.0E-07
sp|P50212|ISL2B_ONCTS Insulin gene enhancer protein ISL-2B (Fragment) OS=Oncorhynchus tshawytscha GN=isl2b PE=2 SV=1 190 301 5.0E-07
sp|Q91V57|CHIN_MOUSE N-chimaerin OS=Mus musculus GN=Chn1 PE=1 SV=2 1031 1247 5.0E-07
sp|P50464|UNC97_CAEEL LIM domain-containing protein unc-97 OS=Caenorhabditis elegans GN=unc-97 PE=1 SV=1 199 316 6.0E-07
sp|Q9P2N2|RHG28_HUMAN Rho GTPase-activating protein 28 OS=Homo sapiens GN=ARHGAP28 PE=1 SV=3 988 1254 7.0E-07
sp|B5DFQ4|RHG26_XENTR Rho GTPase-activating protein 26 OS=Xenopus tropicalis GN=arhgap26 PE=2 SV=1 1071 1250 7.0E-07
sp|Q17QN0|CHIN_BOVIN N-chimaerin OS=Bos taurus GN=CHN1 PE=2 SV=1 1031 1247 7.0E-07
sp|Q8BFW7|LPP_MOUSE Lipoma-preferred partner homolog OS=Mus musculus GN=Lpp PE=1 SV=1 190 339 8.0E-07
sp|Q0VA45|ZYX_XENTR Zyxin OS=Xenopus tropicalis GN=zyx PE=2 SV=1 181 336 9.0E-07
sp|Q9UNA1|RHG26_HUMAN Rho GTPase-activating protein 26 OS=Homo sapiens GN=ARHGAP26 PE=1 SV=1 1071 1247 9.0E-07
sp|P38339|RGD1_YEAST RHO GTPase-activating protein RGD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RGD1 PE=1 SV=1 1043 1247 9.0E-07
sp|Q6KC51|ABLM2_RAT Actin-binding LIM protein 2 OS=Rattus norvegicus GN=Ablim2 PE=1 SV=1 189 300 1.0E-06
sp|O74398|YOCC_SCHPO LIM domain-containing protein C4F6.12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC4F6.12 PE=1 SV=1 189 336 1.0E-06
sp|Q9VDS5|RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster GN=RhoGAP92B PE=1 SV=1 1088 1264 1.0E-06
sp|P53408|ISL2A_ONCTS Insulin gene enhancer protein ISL-2A OS=Oncorhynchus tshawytscha GN=isl2a PE=2 SV=1 169 301 1.0E-06
sp|Q90421|LHX3_DANRE LIM/homeobox protein Lhx3 OS=Danio rerio GN=lhx3 PE=2 SV=1 170 307 1.0E-06
sp|Q6ZQ82|RHG26_MOUSE Rho GTPase-activating protein 26 OS=Mus musculus GN=Arhgap26 PE=1 SV=3 1071 1247 1.0E-06
sp|Q5XI07|LPP_RAT Lipoma-preferred partner homolog OS=Rattus norvegicus GN=Lpp PE=1 SV=1 190 339 1.0E-06
sp|Q99N69|LPXN_MOUSE Leupaxin OS=Mus musculus GN=Lpxn PE=1 SV=2 185 320 2.0E-06
sp|Q86IG9|GACH_DICDI Rho GTPase-activating protein gacH OS=Dictyostelium discoideum GN=gacH PE=3 SV=1 1085 1219 2.0E-06
sp|P53776|LHX4_MOUSE LIM/homeobox protein Lhx4 OS=Mus musculus GN=Lhx4 PE=1 SV=4 168 307 2.0E-06
sp|A5H447|ZYX_XENLA Zyxin OS=Xenopus laevis GN=zyx PE=1 SV=1 190 336 2.0E-06
sp|P29674|LHX1_XENLA LIM/homeobox protein Lhx1 OS=Xenopus laevis GN=lhx1 PE=1 SV=1 190 305 2.0E-06
sp|Q93052|LPP_HUMAN Lipoma-preferred partner OS=Homo sapiens GN=LPP PE=1 SV=1 190 339 2.0E-06
sp|Q90Z06|PRI1A_XENLA Prickle-like protein 1-A OS=Xenopus laevis GN=prickle1-a PE=1 SV=1 151 320 2.0E-06
sp|Q3U5C7|PRIC1_MOUSE Prickle-like protein 1 OS=Mus musculus GN=Prickle1 PE=1 SV=1 151 337 2.0E-06
sp|Q07960|RHG01_HUMAN Rho GTPase-activating protein 1 OS=Homo sapiens GN=ARHGAP1 PE=1 SV=1 1069 1247 2.0E-06
sp|O35652|LHX8_MOUSE LIM/homeobox protein Lhx8 OS=Mus musculus GN=Lhx8 PE=2 SV=4 252 341 2.0E-06
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 190 309 3.0E-06
sp|Q91XD2|LIMS2_MOUSE LIM and senescent cell antigen-like-containing domain protein 2 OS=Mus musculus GN=Lims2 PE=1 SV=1 185 345 3.0E-06
sp|Q90881|LHX9_CHICK LIM/homeobox protein Lhx9 OS=Gallus gallus GN=LHX9 PE=2 SV=2 190 307 3.0E-06
sp|A2PZF9|LHX9_RUGRU LIM/homeobox protein Lhx9 OS=Rugosa rugosa GN=lhx9 PE=2 SV=1 188 305 3.0E-06
sp|Q68G74|LHX8_HUMAN LIM/homeobox protein Lhx8 OS=Homo sapiens GN=LHX8 PE=1 SV=2 252 341 3.0E-06
sp|Q15654|TRIP6_HUMAN Thyroid receptor-interacting protein 6 OS=Homo sapiens GN=TRIP6 PE=1 SV=3 190 343 3.0E-06
sp|Q96MT3|PRIC1_HUMAN Prickle-like protein 1 OS=Homo sapiens GN=PRICKLE1 PE=1 SV=2 151 337 4.0E-06
sp|P52889|LHX5_DANRE LIM/homeobox protein Lhx5 OS=Danio rerio GN=lhx5 PE=2 SV=1 190 319 4.0E-06
sp|P98171|RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens GN=ARHGAP4 PE=1 SV=2 1069 1225 4.0E-06
sp|Q68EY3|LHX9_XENLA LIM/homeobox protein Lhx9 OS=Xenopus laevis GN=lhx9 PE=2 SV=1 188 305 5.0E-06
sp|P53671|LIMK2_HUMAN LIM domain kinase 2 OS=Homo sapiens GN=LIMK2 PE=1 SV=1 190 313 5.0E-06
sp|Q90476|LHX1_DANRE LIM/homeobox protein Lhx1 OS=Danio rerio GN=lhx1a PE=2 SV=1 190 305 5.0E-06
sp|Q5M8V8|RBTN2_XENTR Rhombotin-2 OS=Xenopus tropicalis GN=lmo2 PE=2 SV=1 182 301 5.0E-06
sp|Q28FG2|PRIC1_XENTR Prickle-like protein 1 OS=Xenopus tropicalis GN=prickle1 PE=2 SV=1 151 320 5.0E-06
sp|Q969G2|LHX4_HUMAN LIM/homeobox protein Lhx4 OS=Homo sapiens GN=LHX4 PE=1 SV=2 168 307 5.0E-06
sp|Q90XH3|RBTN2_XENLA Rhombotin-2 OS=Xenopus laevis GN=lmo2 PE=2 SV=1 182 301 6.0E-06
sp|P25801|RBTN2_MOUSE Rhombotin-2 OS=Mus musculus GN=Lmo2 PE=1 SV=1 182 301 6.0E-06
sp|P25791|RBTN2_HUMAN Rhombotin-2 OS=Homo sapiens GN=LMO2 PE=1 SV=1 182 301 6.0E-06
sp|Q1LZ94|RBTN2_BOVIN Rhombotin-2 OS=Bos taurus GN=LMO2 PE=2 SV=1 182 301 6.0E-06
sp|Q9UBR4|LHX3_HUMAN LIM/homeobox protein Lhx3 OS=Homo sapiens GN=LHX3 PE=1 SV=2 175 307 8.0E-06
sp|Q9PTJ3|RBTN2_DANRE Rhombotin-2 OS=Danio rerio GN=lmo2 PE=2 SV=1 182 301 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0007165 signal transduction Yes
GO:0050794 regulation of cellular process No
GO:0008150 biological_process No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093310
MSRENDSGQAPSPWASAVSPKNTPPVSPDNEAARTPQNAVQPQSYPRISPNTSSPNAARPLERPNAPTRSATYGA
PDPDRNLSNTRIPQSRSEDLNHGVSSSPQSPSYLAASPRPSPAFLSSASSSRPSTPGGALNLKPLSSSGHSDDSD
QHLSVNSHVSAQSASSSQSSAVKQAGSVSTTPTSLASTTCSACGKPMHGQFVRALGSVYHLDCFKCVDCGEVVAL
KFFPIEGSDGKQFPLCERDCFRRLNLICAKCGMALRGSYITACNKKFHVEHFTCSVCPTLFGPQDSYYEHEGDIY
CHFHYSTRFATKCAGCNSAILKQFVEINRNMRDECWHPECYMINKFWNVKVVSRRPTSATGEGESQEPAYVEEER
KETASSLKEKQVRMEQQVYRIWTVLSAFEESSAACISDMLRQVSHGQYLDAIRMAEKFILHVEVLFATIDDLEFH
FSQLNMKGMSHVRESRMLCRKTVELFTLLSHTQETGARRMGMTQELLALVTGLAHYLKILIRIALTGALKLEREQ
SAREAMTSFLDKLHLLAIPGGNPGARRMIKGYQEDSSSHGAVNFGTQGVTYGFRSLAPENAGESPFAPSALRDNR
VSSQNPPSDLCVKCNQTVEEDCVRLGTYQRWHSNCIQCTVCGKVALIPMLKDQSSKSGDEKDTKENVTPPAKPSS
ARRPPANVKLFVFDPDSVVETPSFGEVPKVVYCTEHAQSSCKSGFQPVQRLEQYAFLLNVALRRLYLLLKKQGVV
PLSPVATAHGDQGPPASSDPYRNSEYRRVSNVERKSSATARLPKRSTIIESPAGKVAHPSDLGQSGQRSQESTAQ
HQYHTHQHYQHHANGNNNALPSSGPRPTQPQQSPQPQQSSSQQDSLLPYAQPPPSQSSQSPAQSPPQQYAKPNLS
KLPIDPPTGQALRPAFSRNNNEVMILEESAPNSPTGGEENPLGPAKDGKAFSLGDIQSIVEAAQAREQHRSLPRE
TSLPYISRLDPLELALVKHLAVLALMRSPLKDSFDLDEILEMVEPKKSGFWQKLFKPDKKNPKKKVVFGERLDIL
VEREGADSLLGASESALRVPSFIDDVISAMRTMDMSVEGIFRKNGNIKRLNATIEAIDRDPSSVDFTQDNPVQLA
ALLKKFLGFLPEPLMTFKLHRLFAASQNLPSDEDRKRYLHYISLIMPKPHRDTMEVIFVFLKWVASFAHTDSETG
NLMDLPNLATVIAPSIMRARGRDPVRDETFGALRVVTNLLEYQDEFFLVPAEFVQVLQDQEYFVNCMELPGKEFL
KKCETYMKVKGRPPPSNGLHNGSNGIPRYTPMLASPAVERPSPTLPFVSDSRNRQPLPPQVPHAMQTGVPHVPDV
HGSPGAFSLPQGMTPNVQRAPPNEEWQPPPRMRDPNTSSSRSPSFSDAPRPSLDNTQASSSSPHLPSSNSYPSAV
RQRT*
Coding >AgabiH97|093310
ATGAGCAGAGAAAATGATTCCGGACAGGCTCCGTCGCCATGGGCGAGCGCTGTGTCACCGAAGAATACTCCACCA
GTCTCTCCAGACAATGAAGCAGCTCGCACTCCGCAAAACGCAGTCCAACCTCAATCCTATCCGAGAATCTCTCCT
AATACCTCTTCCCCAAACGCTGCTCGACCGTTGGAACGTCCAAATGCTCCCACACGATCAGCAACGTATGGCGCC
CCGGATCCCGATCGCAATCTCTCCAACACTCGGATACCTCAAAGTCGTAGCGAAGACTTGAATCACGGCGTGTCT
TCGTCTCCTCAGAGCCCGAGTTACCTCGCGGCTTCTCCAAGGCCGTCACCAGCCTTTCTTTCTTCTGCCAGCAGC
AGTAGACCATCAACACCTGGAGGCGCATTGAACCTTAAACCCCTTTCATCTTCTGGTCATTCTGATGATTCAGAT
CAGCATCTGAGTGTTAACTCTCATGTATCTGCCCAATCTGCATCTTCATCTCAATCCAGTGCTGTCAAGCAAGCT
GGCTCTGTTTCCACGACCCCTACAAGCCTAGCCTCGACAACGTGTTCGGCTTGTGGCAAGCCCATGCATGGACAG
TTTGTCCGCGCCCTTGGTTCTGTCTATCATCTAGACTGCTTCAAATGTGTGGATTGTGGTGAAGTGGTAGCCCTC
AAATTCTTTCCTATTGAAGGTTCAGATGGGAAGCAGTTTCCCTTGTGTGAACGGGATTGTTTCCGCAGGCTAAAC
CTCATTTGTGCTAAATGTGGCATGGCTCTTAGAGGAAGCTATATCACTGCGTGCAACAAGAAATTTCACGTAGAG
CACTTCACATGCTCAGTCTGTCCTACATTGTTTGGTCCGCAAGACTCTTATTATGAGCATGAGGGGGATATCTAC
TGCCACTTCCATTATTCGACGAGGTTTGCGACCAAGTGTGCGGGATGCAACAGTGCTATCCTGAAGCAGTTTGTG
GAGATCAATCGCAATATGCGAGATGAGTGTTGGCACCCAGAATGTTATATGATCAATAAGTTCTGGAATGTCAAA
GTCGTGTCACGGCGACCTACGAGCGCAACAGGCGAAGGAGAGTCGCAAGAACCGGCCTACGTTGAAGAGGAGCGA
AAAGAAACTGCAAGCTCTTTGAAAGAGAAACAGGTTCGCATGGAACAGCAAGTGTATCGCATCTGGACCGTTCTA
TCTGCATTTGAAGAGTCGAGCGCGGCCTGTATATCGGATATGCTTCGACAAGTCAGCCATGGCCAGTATTTGGAC
GCAATCCGCATGGCAGAGAAATTTATTCTGCATGTTGAGGTGCTATTTGCGACAATTGATGATCTTGAGTTCCAC
TTCTCTCAGCTCAATATGAAAGGCATGTCCCATGTCCGCGAATCTCGCATGTTGTGCCGAAAAACCGTTGAGCTT
TTTACGCTATTATCGCATACCCAAGAGACTGGTGCACGCAGGATGGGCATGACACAAGAGCTACTCGCTTTAGTG
ACGGGTCTGGCACATTACCTGAAGATCCTTATCAGGATTGCGTTAACGGGGGCGCTAAAGCTGGAGAGAGAACAG
AGTGCAAGAGAGGCTATGACGTCGTTTTTGGACAAGCTGCATTTGCTTGCAATCCCAGGAGGAAACCCGGGCGCT
CGGCGGATGATCAAAGGTTATCAAGAGGATTCATCATCACATGGTGCAGTCAACTTTGGTACACAAGGAGTTACC
TATGGTTTTCGGAGTTTAGCACCTGAGAATGCCGGAGAATCGCCATTTGCACCATCTGCCTTACGCGATAACCGA
GTATCGTCCCAAAACCCGCCGTCAGATTTATGTGTCAAGTGTAACCAAACGGTGGAGGAGGATTGTGTGAGGCTA
GGCACGTACCAGCGATGGCATTCGAACTGTATACAGTGTACAGTTTGCGGTAAAGTGGCACTGATACCAATGCTC
AAGGATCAGTCGTCGAAGAGTGGAGACGAGAAAGACACCAAAGAGAATGTGACCCCACCCGCAAAACCTTCTTCT
GCACGCCGTCCACCTGCAAACGTAAAACTCTTTGTATTTGATCCCGACTCGGTGGTAGAAACACCCTCGTTTGGT
GAGGTACCCAAAGTTGTATATTGCACTGAGCATGCCCAGTCCAGCTGCAAAAGTGGTTTCCAACCTGTTCAGCGA
CTTGAGCAATATGCATTCCTACTCAATGTGGCGTTGAGGCGCTTATATTTGCTATTGAAAAAGCAGGGTGTTGTT
CCCTTATCCCCTGTTGCTACCGCACACGGGGATCAAGGTCCTCCGGCGTCTTCTGATCCTTATCGTAATTCCGAA
TACCGGCGGGTGAGCAATGTTGAACGTAAATCATCAGCGACTGCTCGCCTACCCAAGCGGTCGACAATTATTGAA
AGTCCGGCTGGTAAAGTCGCCCACCCGTCCGATCTTGGTCAATCTGGGCAACGGTCACAGGAATCTACGGCTCAG
CACCAGTATCATACTCACCAGCACTATCAGCACCATGCAAATGGTAATAACAATGCTTTGCCCAGTTCAGGTCCC
AGGCCAACTCAACCTCAGCAATCGCCTCAACCGCAACAATCATCCTCACAACAAGACTCCCTGCTTCCATATGCT
CAACCGCCCCCCTCTCAATCCTCTCAATCTCCTGCCCAATCTCCTCCTCAACAATATGCTAAACCTAACCTTTCT
AAGCTTCCCATCGACCCACCGACTGGACAGGCCCTACGACCTGCATTCAGCCGCAATAACAATGAAGTCATGATC
CTGGAAGAGAGTGCACCCAACTCACCGACCGGGGGAGAGGAAAACCCACTTGGGCCTGCCAAGGATGGTAAAGCG
TTTTCACTGGGTGATATACAATCGATCGTAGAGGCAGCACAGGCGCGCGAGCAACATCGATCCCTTCCGCGAGAG
ACTTCCCTTCCGTACATCTCAAGACTCGATCCGCTTGAACTCGCTCTTGTGAAGCACCTTGCCGTGCTTGCCCTG
ATGCGATCACCCTTGAAGGACAGCTTCGACTTGGATGAGATATTGGAGATGGTAGAACCCAAGAAGAGCGGTTTC
TGGCAGAAGCTGTTCAAACCTGACAAAAAGAACCCCAAAAAGAAGGTAGTGTTCGGCGAACGACTCGACATCCTA
GTCGAGAGAGAAGGCGCTGATTCCTTACTCGGTGCAAGCGAAAGTGCCCTTCGAGTACCCAGTTTTATCGACGAC
GTTATCTCTGCAATGAGGACTATGGATATGTCGGTAGAGGGTATCTTCCGCAAGAACGGTAACATCAAACGGCTC
AATGCAACTATAGAAGCCATTGATCGTGACCCCTCCTCGGTCGATTTCACACAGGATAATCCCGTCCAGCTTGCG
GCTTTATTAAAGAAGTTTTTGGGATTTCTTCCAGAGCCGTTAATGACATTCAAGCTCCATCGGTTATTCGCCGCT
TCCCAAAATCTACCGTCAGACGAAGACCGCAAACGTTACCTTCACTATATATCACTTATCATGCCGAAACCCCAC
CGAGATACTATGGAAGTTATCTTTGTTTTCTTGAAGTGGGTCGCATCCTTTGCCCATACGGATTCTGAGACGGGC
AACTTGATGGACCTTCCTAACCTCGCAACTGTGATTGCTCCGAGCATCATGAGGGCAAGAGGTCGTGACCCTGTG
CGCGATGAGACCTTCGGAGCACTTAGGGTTGTTACAAATCTCCTTGAGTACCAAGACGAGTTCTTCCTTGTCCCG
GCGGAATTTGTTCAAGTACTACAGGATCAGGAGTATTTTGTGAACTGCATGGAACTTCCAGGAAAGGAATTCCTC
AAAAAGTGCGAAACTTATATGAAGGTCAAAGGTCGTCCTCCACCATCCAATGGTCTGCACAATGGCTCCAATGGA
ATCCCTCGGTACACCCCTATGCTGGCATCACCAGCCGTTGAACGCCCATCACCGACTTTGCCTTTCGTTTCGGAC
TCTCGAAACAGACAACCGCTACCTCCTCAGGTACCACATGCGATGCAAACTGGTGTACCTCATGTACCTGACGTG
CATGGGTCTCCTGGTGCATTTTCTCTGCCACAGGGAATGACGCCGAATGTGCAGAGAGCACCGCCGAATGAGGAG
TGGCAGCCTCCGCCACGAATGCGCGATCCCAACACATCATCCTCTCGATCACCCTCCTTTTCTGATGCTCCGCGA
CCAAGTCTTGATAATACCCAAGCGTCATCGTCATCACCCCACCTTCCTTCCTCCAACAGCTATCCATCTGCAGTG
CGCCAGCGTACATGA
Transcript >AgabiH97|093310
ATGAGCAGAGAAAATGATTCCGGACAGGCTCCGTCGCCATGGGCGAGCGCTGTGTCACCGAAGAATACTCCACCA
GTCTCTCCAGACAATGAAGCAGCTCGCACTCCGCAAAACGCAGTCCAACCTCAATCCTATCCGAGAATCTCTCCT
AATACCTCTTCCCCAAACGCTGCTCGACCGTTGGAACGTCCAAATGCTCCCACACGATCAGCAACGTATGGCGCC
CCGGATCCCGATCGCAATCTCTCCAACACTCGGATACCTCAAAGTCGTAGCGAAGACTTGAATCACGGCGTGTCT
TCGTCTCCTCAGAGCCCGAGTTACCTCGCGGCTTCTCCAAGGCCGTCACCAGCCTTTCTTTCTTCTGCCAGCAGC
AGTAGACCATCAACACCTGGAGGCGCATTGAACCTTAAACCCCTTTCATCTTCTGGTCATTCTGATGATTCAGAT
CAGCATCTGAGTGTTAACTCTCATGTATCTGCCCAATCTGCATCTTCATCTCAATCCAGTGCTGTCAAGCAAGCT
GGCTCTGTTTCCACGACCCCTACAAGCCTAGCCTCGACAACGTGTTCGGCTTGTGGCAAGCCCATGCATGGACAG
TTTGTCCGCGCCCTTGGTTCTGTCTATCATCTAGACTGCTTCAAATGTGTGGATTGTGGTGAAGTGGTAGCCCTC
AAATTCTTTCCTATTGAAGGTTCAGATGGGAAGCAGTTTCCCTTGTGTGAACGGGATTGTTTCCGCAGGCTAAAC
CTCATTTGTGCTAAATGTGGCATGGCTCTTAGAGGAAGCTATATCACTGCGTGCAACAAGAAATTTCACGTAGAG
CACTTCACATGCTCAGTCTGTCCTACATTGTTTGGTCCGCAAGACTCTTATTATGAGCATGAGGGGGATATCTAC
TGCCACTTCCATTATTCGACGAGGTTTGCGACCAAGTGTGCGGGATGCAACAGTGCTATCCTGAAGCAGTTTGTG
GAGATCAATCGCAATATGCGAGATGAGTGTTGGCACCCAGAATGTTATATGATCAATAAGTTCTGGAATGTCAAA
GTCGTGTCACGGCGACCTACGAGCGCAACAGGCGAAGGAGAGTCGCAAGAACCGGCCTACGTTGAAGAGGAGCGA
AAAGAAACTGCAAGCTCTTTGAAAGAGAAACAGGTTCGCATGGAACAGCAAGTGTATCGCATCTGGACCGTTCTA
TCTGCATTTGAAGAGTCGAGCGCGGCCTGTATATCGGATATGCTTCGACAAGTCAGCCATGGCCAGTATTTGGAC
GCAATCCGCATGGCAGAGAAATTTATTCTGCATGTTGAGGTGCTATTTGCGACAATTGATGATCTTGAGTTCCAC
TTCTCTCAGCTCAATATGAAAGGCATGTCCCATGTCCGCGAATCTCGCATGTTGTGCCGAAAAACCGTTGAGCTT
TTTACGCTATTATCGCATACCCAAGAGACTGGTGCACGCAGGATGGGCATGACACAAGAGCTACTCGCTTTAGTG
ACGGGTCTGGCACATTACCTGAAGATCCTTATCAGGATTGCGTTAACGGGGGCGCTAAAGCTGGAGAGAGAACAG
AGTGCAAGAGAGGCTATGACGTCGTTTTTGGACAAGCTGCATTTGCTTGCAATCCCAGGAGGAAACCCGGGCGCT
CGGCGGATGATCAAAGGTTATCAAGAGGATTCATCATCACATGGTGCAGTCAACTTTGGTACACAAGGAGTTACC
TATGGTTTTCGGAGTTTAGCACCTGAGAATGCCGGAGAATCGCCATTTGCACCATCTGCCTTACGCGATAACCGA
GTATCGTCCCAAAACCCGCCGTCAGATTTATGTGTCAAGTGTAACCAAACGGTGGAGGAGGATTGTGTGAGGCTA
GGCACGTACCAGCGATGGCATTCGAACTGTATACAGTGTACAGTTTGCGGTAAAGTGGCACTGATACCAATGCTC
AAGGATCAGTCGTCGAAGAGTGGAGACGAGAAAGACACCAAAGAGAATGTGACCCCACCCGCAAAACCTTCTTCT
GCACGCCGTCCACCTGCAAACGTAAAACTCTTTGTATTTGATCCCGACTCGGTGGTAGAAACACCCTCGTTTGGT
GAGGTACCCAAAGTTGTATATTGCACTGAGCATGCCCAGTCCAGCTGCAAAAGTGGTTTCCAACCTGTTCAGCGA
CTTGAGCAATATGCATTCCTACTCAATGTGGCGTTGAGGCGCTTATATTTGCTATTGAAAAAGCAGGGTGTTGTT
CCCTTATCCCCTGTTGCTACCGCACACGGGGATCAAGGTCCTCCGGCGTCTTCTGATCCTTATCGTAATTCCGAA
TACCGGCGGGTGAGCAATGTTGAACGTAAATCATCAGCGACTGCTCGCCTACCCAAGCGGTCGACAATTATTGAA
AGTCCGGCTGGTAAAGTCGCCCACCCGTCCGATCTTGGTCAATCTGGGCAACGGTCACAGGAATCTACGGCTCAG
CACCAGTATCATACTCACCAGCACTATCAGCACCATGCAAATGGTAATAACAATGCTTTGCCCAGTTCAGGTCCC
AGGCCAACTCAACCTCAGCAATCGCCTCAACCGCAACAATCATCCTCACAACAAGACTCCCTGCTTCCATATGCT
CAACCGCCCCCCTCTCAATCCTCTCAATCTCCTGCCCAATCTCCTCCTCAACAATATGCTAAACCTAACCTTTCT
AAGCTTCCCATCGACCCACCGACTGGACAGGCCCTACGACCTGCATTCAGCCGCAATAACAATGAAGTCATGATC
CTGGAAGAGAGTGCACCCAACTCACCGACCGGGGGAGAGGAAAACCCACTTGGGCCTGCCAAGGATGGTAAAGCG
TTTTCACTGGGTGATATACAATCGATCGTAGAGGCAGCACAGGCGCGCGAGCAACATCGATCCCTTCCGCGAGAG
ACTTCCCTTCCGTACATCTCAAGACTCGATCCGCTTGAACTCGCTCTTGTGAAGCACCTTGCCGTGCTTGCCCTG
ATGCGATCACCCTTGAAGGACAGCTTCGACTTGGATGAGATATTGGAGATGGTAGAACCCAAGAAGAGCGGTTTC
TGGCAGAAGCTGTTCAAACCTGACAAAAAGAACCCCAAAAAGAAGGTAGTGTTCGGCGAACGACTCGACATCCTA
GTCGAGAGAGAAGGCGCTGATTCCTTACTCGGTGCAAGCGAAAGTGCCCTTCGAGTACCCAGTTTTATCGACGAC
GTTATCTCTGCAATGAGGACTATGGATATGTCGGTAGAGGGTATCTTCCGCAAGAACGGTAACATCAAACGGCTC
AATGCAACTATAGAAGCCATTGATCGTGACCCCTCCTCGGTCGATTTCACACAGGATAATCCCGTCCAGCTTGCG
GCTTTATTAAAGAAGTTTTTGGGATTTCTTCCAGAGCCGTTAATGACATTCAAGCTCCATCGGTTATTCGCCGCT
TCCCAAAATCTACCGTCAGACGAAGACCGCAAACGTTACCTTCACTATATATCACTTATCATGCCGAAACCCCAC
CGAGATACTATGGAAGTTATCTTTGTTTTCTTGAAGTGGGTCGCATCCTTTGCCCATACGGATTCTGAGACGGGC
AACTTGATGGACCTTCCTAACCTCGCAACTGTGATTGCTCCGAGCATCATGAGGGCAAGAGGTCGTGACCCTGTG
CGCGATGAGACCTTCGGAGCACTTAGGGTTGTTACAAATCTCCTTGAGTACCAAGACGAGTTCTTCCTTGTCCCG
GCGGAATTTGTTCAAGTACTACAGGATCAGGAGTATTTTGTGAACTGCATGGAACTTCCAGGAAAGGAATTCCTC
AAAAAGTGCGAAACTTATATGAAGGTCAAAGGTCGTCCTCCACCATCCAATGGTCTGCACAATGGCTCCAATGGA
ATCCCTCGGTACACCCCTATGCTGGCATCACCAGCCGTTGAACGCCCATCACCGACTTTGCCTTTCGTTTCGGAC
TCTCGAAACAGACAACCGCTACCTCCTCAGGTACCACATGCGATGCAAACTGGTGTACCTCATGTACCTGACGTG
CATGGGTCTCCTGGTGCATTTTCTCTGCCACAGGGAATGACGCCGAATGTGCAGAGAGCACCGCCGAATGAGGAG
TGGCAGCCTCCGCCACGAATGCGCGATCCCAACACATCATCCTCTCGATCACCCTCCTTTTCTGATGCTCCGCGA
CCAAGTCTTGATAATACCCAAGCGTCATCGTCATCACCCCACCTTCCTTCCTCCAACAGCTATCCATCTGCAGTG
CGCCAGCGTACATGA
Gene >AgabiH97|093310
ATGAGCAGAGAAAATGATTCCGGACAGGCTCCGTCGCCATGGGCGAGCGCTGTGTCACCGAAGAATACTCCACCA
GTCTCTCCAGACAATGAAGCAGCTCGCACTCCGCAAAACGCAGTCCAACCTCAATCCTATCCGAGAATCTCTCCT
AATACCTCTTCCCCAAACGCTGCTCGACCGTTGGAACGTCCAAATGCTCCCACACGATCAGCAACGTATGGCGCC
CCGGATCCCGATCGCAATCTCTCCAACACTCGGATACCTCAAAGTCGTAGCGAAGACTTGAATCACGGCGTGTCT
TCGTCTCCTCAGAGCCCGAGTTACCTCGCGGCTTCTCCAAGGCCGTCACCAGCCTTTCTTTCTTCTGCCAGCAGC
AGTAGACCATCAACACCTGGAGGCGCATTGAACCTTAAACCCCTTTCATCTTCTGGTCATTCTGATGATTCAGAT
CAGCATCTGAGTGTTAACTCTCATGTATCTGCCCAATCTGCATCTTCATCTCAATCCAGTGCTGTCAAGCAAGCT
GGCTCTGTTTCCACGACCCCTACAAGCCTAGCCTCGACGTGAGTACGATCATCTGAATAAACTGAACCTCTTAAT
TGCGCGTCATATTCACTAACATGCTTTTGATTCATCTATTTCATAGAACGTGTTCGGCTTGTGGCAAGCCCATGC
ATGGACAGTTTGTCCGCGCCCTTGGTTCTGTCTATCATCTAGACTGCTTCAAATGTGTGGTAAGTGCTTTGCACA
TGGTTCATAATCAAATTGGGACTAACGTTTTTTGAAGGATTGTGGTGAAGTGGTAGCCCTCAAATTCTTTCCTAT
TGAAGGTTCAGATGGGAAGCAGTTTCCCTTGTGTGAACGGGATTGTTTCCGCAGGCTAAACCTCATTTGTGCTAA
ATGTGGCATGGCTCTTAGAGGAAGCTATATCACTGCGTGCAGTAAGTGTTTAAAATAAAACTTGTCAATTCATTT
CCGGTTTATTAATTTGTTATCATAGACAAGAAATTTCACGTAGAGCACTTCACATGCTCAGTCTGTCCTACATTG
TTTGGTCCGCAAGACTCTTATTATGAGCATGAGGGGGATATCTACTGCCACTTCCATTATTCGACGAGGTTTGCG
ACCAAGTGTGCGGGATGCAACAGTGCTATCCTGAAGCAGTTTGTGGAGATCAATCGCAATATGCGAGATGAGTGT
TGGCACCCAGAATGTTATATGATCAATAAGGTGATTCACTCAGTTTTTGTCGTTTCTTAATTATCAACTAAGATC
AATTTACAGTTCTGGAATGTCAAAGTCGTGTCACGGCGACCTACGAGCGCAACAGGCGAAGGAGAGTCGCAAGAA
CCGGCCTACGTTGAAGAGGAGCGAAAAGAAACTGCAAGCTCTTTGAAAGAGAAACAGGTTCGCATGGAACAGCAA
GTGTATCGCATCTGGACGTGCGTACCTCAGTGCTCTGCTGTCAACTCAATTGACAAATCCCTCTTTCATAGCGTT
CTATCTGCATTTGAAGAGTCGAGCGCGGCCTGTATATCGGATATGCTTCGACAAGTCAGCCATGGCCAGTATTTG
GACGCAATCCGCATGGCAGAGAAATTTATTCTGCATGTTGAGGTGCTATTTGCGACAATTGATGATCTTGAGTTC
CACTTCTCTCAGCTCAATATGAAAGGTAAGTTACTACTTCAGGGTGGTGAAGAGCGTGATATCTTACTTTCGAAA
ATAGGCATGTCCCATGTCCGCGAATCTCGCATGTTGTGCCGAAAAACCGTTGAGCTTTTTACGCTATTATCGCAT
ACCCAAGAGACTGGTGCACGCAGGATGGGCATGACACAAGAGCTACTCGCTTTAGTGACGGGTCTGGCACATTAC
CTGAAGATCCTTATCAGGATTGCGTTAACGGGGGCGCTAAAGCTGGAGAGAGAACAGAGTGCAAGAGAGGCTATG
ACGTCGTTTTTGGACAAGCTGCATTTGCTTGCAATCCCAGGAGGAAACCCGGGCGCTCGGCGGATGATCAAAGGT
TATCAAGAGGATTCATCATCACATGGTGCAGTCAACTTTGGTACACAAGGAGTTACCTATGGTTTTCGGAGTTTA
GCACCTGAGAATGCCGGAGAATCGCCATTTGCACCATCTGCCTTACGCGATAACCGAGTATCGTCCCAAAACCCG
CCGTCAGATTTATGTGTCAAGTGTAACCAAACGGTGGAGGAGGATTGTGTGAGGCTAGGCACGTACCAGCGATGG
CATTCGAACTGTATACAGTGTACAGTTTGCGGTAAAGTGGCACTGATACCAATGCTCAAGGATCAGTCGTCGAAG
AGTGGAGACGAGAAAGACACCAAAGAGAATGTGACCCCACCCGCAAAACCTTCTTCTGCACGCCGTCCACCTGCA
AACGTAAAACTCTTTGTATTTGATCCCGACTCGGTGGTAGAAACACCCTCGTTTGGTGAGGTACCCAAAGTTGTA
TATTGCACTGAGCATGCCCAGTCCAGCTGCAAAAGTGGTTTCCAACCTGTTCAGCGACTTGAGCAATATGCATTC
CTACTCAATGTGGCGTTGAGGCGCTTATATTTGCTATTGAAAAAGCAGGGTGTTGTTCCCTTATCCCCTGGTGTG
TATATCTATTATAAACGCATCTGAGCTGATCCTTACCGCTTCCTTACAGTTGCTACCGCACACGGGGATCAAGGT
CCTCCGGCGTCTTCTGATCCTTATCGTAATTCCGAATACCGGCGGGTGAGCAATGTTGAACGTAAATCATCAGCG
ACTGCTCGCCTACCCAAGCGGTCGACAATTATTGAAAGTCCGGCTGGTAAAGTCGCCCACCCGTCCGATCTTGGT
CAATCTGGGCAACGGTCACAGGAATCTACGGCTCAGCACCAGTATCATACTCACCAGCACTATCAGCACCATGCA
AATGGTAATAACAATGCTTTGCCCAGTTCAGGTCCCAGGCCAACTCAACCTCAGCAATCGCCTCAACCGCAACAA
TCATCCTCACAACAAGACTCCCTGCTTCCATATGCTCAACCGCCCCCCTCTCAATCCTCTCAATCTCCTGCCCAA
TCTCCTCCTCAACAATATGCTAAACCTAACCTTTCTAAGCTTCCCATCGACCCACCGACTGGACAGGCCCTACGA
CCTGCATTCAGCCGCAATAACAATGAAGTCATGATCCTGGAAGAGAGTGCACCCAACTCACCGACCGGGGGAGAG
GAAAACCCACTTGGGCCTGCCAAGGATGGTAAAGCGTTTTCACTGGGTGATATACAATCGATCGTAGAGGCAGCA
CAGGCGCGCGAGCAACATCGATCCCTTCCGCGAGAGACTTCCCTTCCGTACATCTCAAGACTCGATCCGCTTGAA
CTCGCTCTTGTGAAGCACCTTGCCGTGCTTGCCCTGATGCGATCACCCTTGAAGGACAGCTTCGACTTGGATGAG
ATATTGGAGATGGTAGAACCCAAGAAGAGCGGTTTCTGGCAGAAGCTGTTCAAACCTGACAAAAAGAACCCCAAA
AAGAAGGGTGTGTTACATATCACTCTGATGTCAATAGACCCTTATTTTGCCCCTAGTAGTGTTCGGCGAACGACT
CGACATCCTAGTCGAGAGAGAAGGCGCTGATTCCTTACTCGGTGCAAGCGAAAGTGCCCTTCGAGTACCCAGTTT
TATCGACGACGTTATCTCTGCAATGAGGACTATGGGTGGGTTCTTTGAGCTAATTTTGCGTTCGACAGGCGCCTG
ATTGTTTATGATCCAGATATGTCGGTAGAGGGTATCTTCCGCAAGAACGGTAACATCAAACGGCTCAATGCAACT
ATAGAAGCCATTGATCGTGACCCCTCCTCGGTCGATTTCACACAGGATAATCCCGTCCAGCTTGCGGCTTTATTA
AAGAAGTTTTTGGGATTTCTTCCAGAGCCGTTAATGACATTCAAGCTCCATCGGTTATTCGCCGCTTCCCAAAGT
GATTCATATCTGTACTTTATGCTATTCCAAGGCTAAAGTCTTTCTTTCTTATAGATCTACCGTCAGACGAAGACC
GCAAACGTTACCTTCACTATATATCACTTATCATGCCGAAACCCCACCGAGATACTATGGAAGTTATCTTTGTTT
TCTTGAAGTGGGTCGCATCCTTTGCCCATACGGATTCTGAGACGGGCAACTTGATGGACCTTCCTAACCTCGCAA
CTGTGATTGCTCCGAGCATCATGAGGGCAAGAGGTCGTGACCCTGTGCGCGATGAGACCTTCGGAGCACTTAGGG
TTGTTACAAATCTCCTTGAGTACCAAGACGAGTTCTTCCTTGTCCCGGCGGAATTTGTTCAAGTACTACAGGATC
AGGAGTATTTTGTGAACTGCATGGAACTTCCAGGAAAGGAATTCCTCAAAAAGTGCGAAACTTATATGAAGGTCA
AAGGTCGTCCTCCACCATCCAATGGTCTGCACAATGGCTCCAATGGAATCCCTCGGTACACCCCTATGCTGGCAT
CACCAGCCGTTGAACGCCCATCACCGACTTTGCCTTTCGTTTCGGACTCTCGAAACAGACAACCGCTACCTCCTC
AGGTACCACATGCGATGCAAACTGGTGTACCTCATGTACCTGACGTGCATGGGTCTCCTGGTGCATTTTCTCTGC
CACAGGGAATGACGCCGAATGTGCAGAGAGCACCGCCGAATGAGGAGTGGCAGCCTCCGCCACGAATGCGCGATC
CCAACACATCATCCTCTCGATCACCCTCCTTTTCTGATGCTCCGCGACCAAGTCTTGATAATACCCAAGCGTCAT
CGTCATCACCCCACCTTCCTTCCTCCAACAGCTATCCATCTGCAGTGCGCCAGCGTACATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail