Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093200
Gene name
Locationscaffold_6:1282326..1283061
Strand-
Gene length (bp)735
Transcript length (bp)579
Coding sequence length (bp)579
Protein length (aa) 193

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|P43317|GUN5_HYPJE Endoglucanase-5 OS=Hypocrea jecorina GN=egl5 PE=3 SV=1 47 128 4.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093200
MKLTALVVFLTAVVGTNAWVQRASGSASFTQYSGCGAPACGKTASGFTAAVNQLMFGASPGLGPGDACGRCFSVT
ATADPFSPAYMGPFHTIVVKVTDLCPINGNQEWCGQTSSNTNNQHGQPFHFDICGDTGGAGAFFPSGHGALIGNF
QEVSCSQWSGSDGGSLFNGACLDGETAGNWPSTACGNQGTSP*
Coding >AgabiH97|093200
ATGAAATTGACTGCCCTAGTTGTCTTTCTCACCGCAGTTGTTGGAACAAATGCCTGGGTTCAGAGAGCCTCTGGA
TCTGCTTCCTTCACCCAATACTCAGGTTGCGGTGCACCAGCCTGTGGAAAAACTGCCTCTGGTTTCACCGCAGCT
GTGAACCAATTGATGTTTGGTGCTTCACCTGGCCTTGGTCCAGGCGACGCTTGTGGACGCTGTTTCTCTGTTACT
GCTACCGCTGATCCTTTCTCTCCTGCGTACATGGGTCCATTTCATACTATTGTAGTCAAGGTGACAGATCTCTGC
CCAATCAACGGAAATCAGGAGTGGTGCGGTCAAACATCAAGCAACACAAACAACCAGCATGGACAACCATTCCAC
TTCGACATTTGTGGGGATACGGGAGGAGCTGGAGCTTTCTTCCCGTCTGGCCATGGTGCCCTGATAGGCAATTTC
CAAGAAGTATCTTGTAGCCAATGGTCTGGTTCTGATGGGGGCTCTTTGTTTAATGGCGCATGCCTTGACGGTGAA
ACAGCGGGAAATTGGCCGTCAACTGCATGCGGTAACCAGGGAACTTCACCCTGA
Transcript >AgabiH97|093200
ATGAAATTGACTGCCCTAGTTGTCTTTCTCACCGCAGTTGTTGGAACAAATGCCTGGGTTCAGAGAGCCTCTGGA
TCTGCTTCCTTCACCCAATACTCAGGTTGCGGTGCACCAGCCTGTGGAAAAACTGCCTCTGGTTTCACCGCAGCT
GTGAACCAATTGATGTTTGGTGCTTCACCTGGCCTTGGTCCAGGCGACGCTTGTGGACGCTGTTTCTCTGTTACT
GCTACCGCTGATCCTTTCTCTCCTGCGTACATGGGTCCATTTCATACTATTGTAGTCAAGGTGACAGATCTCTGC
CCAATCAACGGAAATCAGGAGTGGTGCGGTCAAACATCAAGCAACACAAACAACCAGCATGGACAACCATTCCAC
TTCGACATTTGTGGGGATACGGGAGGAGCTGGAGCTTTCTTCCCGTCTGGCCATGGTGCCCTGATAGGCAATTTC
CAAGAAGTATCTTGTAGCCAATGGTCTGGTTCTGATGGGGGCTCTTTGTTTAATGGCGCATGCCTTGACGGTGAA
ACAGCGGGAAATTGGCCGTCAACTGCATGCGGTAACCAGGGAACTTCACCCTGA
Gene >AgabiH97|093200
ATGAAATTGACTGCCCTAGTTGTCTTTCTCACCGCAGTTGTTGGAACAAATGCCTGGGTTCAGAGAGCCTCTGGA
TCTGCTTCCTTCACCCAATACTCAGGTTGCGGTGCACCAGCCTGTGGAAAAACTGCCTCTGGTTTCACCGCAGCT
GTGAACCAATTGATGTTTGGTGCTTCACCTGGCCTTGGTCCAGGCGACGCTTGTGGACGCTGTTTCTCTGTTACT
GCTACCGCTGATCCTTTCTCTCCTGCGTACATGGGTCCATTTCATACTATTGTAGTCAAGGTGACAGATCTCTGG
TAGGTTATTCTCTTATATTTGGAATATCTGGCAGATTATGGACCTTCAACAGCCCAATCAACGGAAATCAGGCAC
GATGATAAATTCAATTAAGCAAATGATCAACAAGCTAACATAGACCCAAGGAGTGGTGCGGTCAAACATCAAGCA
ACACAAACAACCAGCATGGACAACCATTCCAGTGACTTTTCCTTTTCTCGAAGGTGGACACAACACTGAATCACA
AACAGCTTCGACATTTGTGGGGATACGGGAGGAGCTGGAGCTTTCTTCCCGTCTGGCCATGGTGCCCTGATAGGC
AATTTCCAAGAAGTATCTTGTAGCCAATGGTCTGGTTCTGATGGGGGCTCTTTGTTTAATGGCGCATGCCTTGAC
GGTGAAACAGCGGGAAATTGGCCGTCAACTGCATGCGGTAACCAGGGAACTTCACCCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail