Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|093130
Gene name
Locationscaffold_6:1271118..1272231
Strand-
Gene length (bp)1113
Transcript length (bp)798
Coding sequence length (bp)798
Protein length (aa) 266

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00926 DHBP_synthase 3,4-dihydroxy-2-butanone 4-phosphate synthase 2.5E-78 75 254

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O60181|RIB3_SCHPO 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.06c PE=3 SV=1 72 254 2.0E-71
sp|Q5A3V6|RIB3_CANAL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIB3 PE=1 SV=2 70 253 2.0E-66
sp|Q8UE66|RIBB_AGRFC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ribB PE=3 SV=1 68 265 6.0E-62
sp|C0ZZE5|RIBBA_RHOE4 Riboflavin biosynthesis protein RibBA OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ribBA PE=3 SV=1 70 252 2.0E-60
sp|Q0S0K2|RIBBA_RHOJR Riboflavin biosynthesis protein RibBA OS=Rhodococcus jostii (strain RHA1) GN=ribBA PE=3 SV=1 70 252 3.0E-60
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O60181|RIB3_SCHPO 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC23E6.06c PE=3 SV=1 72 254 2.0E-71
sp|Q5A3V6|RIB3_CANAL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=RIB3 PE=1 SV=2 70 253 2.0E-66
sp|Q8UE66|RIBB_AGRFC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=ribB PE=3 SV=1 68 265 6.0E-62
sp|C0ZZE5|RIBBA_RHOE4 Riboflavin biosynthesis protein RibBA OS=Rhodococcus erythropolis (strain PR4 / NBRC 100887) GN=ribBA PE=3 SV=1 70 252 2.0E-60
sp|Q0S0K2|RIBBA_RHOJR Riboflavin biosynthesis protein RibBA OS=Rhodococcus jostii (strain RHA1) GN=ribBA PE=3 SV=1 70 252 3.0E-60
sp|Q99258|RIB3_YEAST 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RIB3 PE=1 SV=1 70 253 4.0E-60
sp|Q8TG90|RIB3_MAGO7 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Magnaporthe oryzae (strain 70-15 / ATCC MYA-4617 / FGSC 8958) GN=RIB3 PE=1 SV=1 69 259 5.0E-59
sp|Q741F1|RIBBA_MYCPA Riboflavin biosynthesis protein RibBA OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=ribBA PE=3 SV=1 70 252 2.0E-58
sp|A0QI09|RIBBA_MYCA1 Riboflavin biosynthesis protein RibBA OS=Mycobacterium avium (strain 104) GN=ribBA PE=3 SV=1 70 252 2.0E-58
sp|P9WHF1|RIBBA_MYCTU Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=ribBA PE=1 SV=1 70 252 5.0E-58
sp|P9WHF0|RIBBA_MYCTO Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=ribBA PE=3 SV=1 70 252 5.0E-58
sp|A5U2B7|RIBBA_MYCTA Riboflavin biosynthesis protein RibBA OS=Mycobacterium tuberculosis (strain ATCC 25177 / H37Ra) GN=ribBA PE=1 SV=1 70 252 5.0E-58
sp|C1AN60|RIBBA_MYCBT Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain BCG / Tokyo 172 / ATCC 35737 / TMC 1019) GN=ribBA PE=3 SV=1 70 252 5.0E-58
sp|A1KIK4|RIBBA_MYCBP Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain BCG / Pasteur 1173P2) GN=ribBA PE=3 SV=1 70 252 5.0E-58
sp|P0A5V1|RIBBA_MYCBO Riboflavin biosynthesis protein RibBA OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=ribBA PE=3 SV=1 70 252 5.0E-58
sp|B2HP67|RIBBA_MYCMM Riboflavin biosynthesis protein RibBA OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=ribBA PE=3 SV=1 70 252 7.0E-58
sp|A0PPL6|RIBBA_MYCUA Riboflavin biosynthesis protein RibBA OS=Mycobacterium ulcerans (strain Agy99) GN=ribBA PE=3 SV=1 70 252 9.0E-58
sp|Q0E079|RIBA2_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 2, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA2 PE=2 SV=1 70 253 2.0E-57
sp|A8LY38|RIBBA_SALAI Riboflavin biosynthesis protein RibBA OS=Salinispora arenicola (strain CNS-205) GN=ribBA PE=3 SV=1 69 250 4.0E-57
sp|A1T8K1|RIBBA_MYCVP Riboflavin biosynthesis protein RibBA OS=Mycobacterium vanbaalenii (strain DSM 7251 / PYR-1) GN=ribBA PE=3 SV=1 70 252 5.0E-57
sp|A4TC13|RIBBA_MYCGI Riboflavin biosynthesis protein RibBA OS=Mycobacterium gilvum (strain PYR-GCK) GN=ribBA PE=3 SV=1 70 252 7.0E-57
sp|Q6NLQ7|RIBA2_ARATH Monofunctional riboflavin biosynthesis protein RIBA 2, chloroplastic OS=Arabidopsis thaliana GN=RIBA2 PE=1 SV=1 70 251 2.0E-56
sp|A5UDW2|RIBB_HAEIE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Haemophilus influenzae (strain PittEE) GN=ribB PE=3 SV=1 76 265 3.0E-56
sp|A4X639|RIBBA_SALTO Riboflavin biosynthesis protein RibBA OS=Salinispora tropica (strain ATCC BAA-916 / DSM 44818 / CNB-440) GN=ribBA PE=3 SV=1 69 250 3.0E-56
sp|A5UHR8|RIBB_HAEIG 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Haemophilus influenzae (strain PittGG) GN=ribB PE=3 SV=1 76 265 6.0E-56
sp|P47924|RIBA1_ARATH Bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic OS=Arabidopsis thaliana GN=RIBA1 PE=1 SV=2 70 251 1.0E-55
sp|B0K0Y9|RIBBA_THEPX Riboflavin biosynthesis protein RibBA OS=Thermoanaerobacter sp. (strain X514) GN=ribBA PE=3 SV=1 70 254 2.0E-55
sp|B0KAI2|RIBBA_THEP3 Riboflavin biosynthesis protein RibBA OS=Thermoanaerobacter pseudethanolicus (strain ATCC 33223 / 39E) GN=ribBA PE=3 SV=1 70 254 2.0E-55
sp|Q6Z234|RIBA1_ORYSJ Probable bifunctional riboflavin biosynthesis protein RIBA 1, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA1 PE=2 SV=1 70 253 3.0E-55
sp|P44866|RIBB_HAEIN 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=ribB PE=3 SV=1 76 265 5.0E-55
sp|Q5YTP3|RIBBA_NOCFA Riboflavin biosynthesis protein RibBA OS=Nocardia farcinica (strain IFM 10152) GN=ribBA PE=3 SV=1 70 252 7.0E-55
sp|B1MCA4|RIBBA_MYCA9 Riboflavin biosynthesis protein RibBA OS=Mycobacterium abscessus (strain ATCC 19977 / DSM 44196 / CIP 104536 / JCM 13569 / NCTC 13031 / TMC 1543) GN=ribBA PE=3 SV=1 70 252 1.0E-54
sp|A7MP95|RIBB_CROS8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=ribB PE=3 SV=1 69 251 2.0E-54
sp|C4LDD2|RIBB_TOLAT 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=ribB PE=3 SV=1 70 260 4.0E-54
sp|O66679|RIBBA_AQUAE Riboflavin biosynthesis protein RibBA OS=Aquifex aeolicus (strain VF5) GN=ribBA PE=3 SV=1 64 253 8.0E-54
sp|Q8NQ52|RIBBA_CORGL Riboflavin biosynthesis protein RibBA OS=Corynebacterium glutamicum (strain ATCC 13032 / DSM 20300 / JCM 1318 / LMG 3730 / NCIMB 10025) GN=ribBA PE=3 SV=1 69 252 2.0E-53
sp|A4QEG9|RIBBA_CORGB Riboflavin biosynthesis protein RibBA OS=Corynebacterium glutamicum (strain R) GN=ribBA PE=3 SV=1 69 252 2.0E-53
sp|A6TE29|RIBB_KLEP7 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=ribB PE=3 SV=1 69 253 3.0E-53
sp|B5XU43|RIBB_KLEP3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Klebsiella pneumoniae (strain 342) GN=ribB PE=3 SV=1 69 253 3.0E-53
sp|B1H0I0|RIBBA_UNCTG Riboflavin biosynthesis protein RibBA OS=Uncultured termite group 1 bacterium phylotype Rs-D17 GN=ribBA PE=3 SV=1 70 253 6.0E-53
sp|Q4QMD5|RIBB_HAEI8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Haemophilus influenzae (strain 86-028NP) GN=ribB PE=3 SV=1 76 265 7.0E-53
sp|C5BHH8|RIBB_EDWI9 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Edwardsiella ictaluri (strain 93-146) GN=ribB PE=3 SV=1 70 251 9.0E-53
sp|A8GJU0|RIBB_SERP5 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Serratia proteamaculans (strain 568) GN=ribB PE=3 SV=1 71 253 9.0E-53
sp|A4WEI2|RIBB_ENT38 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Enterobacter sp. (strain 638) GN=ribB PE=3 SV=1 69 251 1.0E-52
sp|P66032|RIBB_SALTY 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ribB PE=1 SV=1 70 251 2.0E-52
sp|P66033|RIBB_SALTI 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella typhi GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B4TVS9|RIBB_SALSV 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella schwarzengrund (strain CVM19633) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|C0PYW8|RIBB_SALPC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella paratyphi C (strain RKS4594) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|A9N5X2|RIBB_SALPB 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B4T665|RIBB_SALNS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella newport (strain SL254) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B4TI45|RIBB_SALHS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella heidelberg (strain SL476) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B5REF3|RIBB_SALG2 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B5QZ31|RIBB_SALEP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella enteritidis PT4 (strain P125109) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B5FHS9|RIBB_SALDC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella dublin (strain CT_02021853) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|Q57JR5|RIBB_SALCH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella choleraesuis (strain SC-B67) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B5F690|RIBB_SALA4 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella agona (strain SL483) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|Q3YXK0|RIBB_SHISS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella sonnei (strain Ss046) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|P0A7J2|RIBB_SHIFL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella flexneri GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q0T0L7|RIBB_SHIF8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella flexneri serotype 5b (strain 8401) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q32BS1|RIBB_SHIDS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q31WZ1|RIBB_SHIBS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella boydii serotype 4 (strain Sb227) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B2U1F0|RIBB_SHIB3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B6I413|RIBB_ECOSE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain SE11) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|P0A7J0|RIBB_ECOLI 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain K12) GN=ribB PE=1 SV=1 70 253 2.0E-52
sp|B1ISB5|RIBB_ECOLC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q0TD60|RIBB_ECOL5 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|A8A4J8|RIBB_ECOHS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O9:H4 (strain HS) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B1XG46|RIBB_ECODH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain K12 / DH10B) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|C4ZQV9|RIBB_ECOBW 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7LZJ1|RIBB_ECO8A 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O8 (strain IAI1) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7NJQ5|RIBB_ECO7I 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B5YR87|RIBB_ECO5E 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|P0A7J1|RIBB_ECO57 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O157:H7 GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7LGI1|RIBB_ECO55 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain 55989 / EAEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|A7ZRS4|RIBB_ECO24 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q1R6T4|RIBB_ECOUT 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain UTI89 / UPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|Q8FDH9|RIBB_ECOL6 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|A1AFX0|RIBB_ECOK1 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O1:K1 / APEC GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7N0J6|RIBB_ECO81 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O81 (strain ED1a) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7MAC3|RIBB_ECO45 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7UIV5|RIBB_ECO27 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|O25484|RIBB_HELPY 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=ribB PE=3 SV=1 73 246 2.0E-52
sp|B1LF38|RIBB_ECOSM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|B7ND35|RIBB_ECOLU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|A0Q3H7|RIBBA_CLONN Riboflavin biosynthesis protein RibBA OS=Clostridium novyi (strain NT) GN=ribBA PE=3 SV=1 68 251 2.0E-52
sp|Q9ZL40|RIBB_HELPJ 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=ribB PE=3 SV=1 73 246 2.0E-52
sp|B5BG06|RIBB_SALPK 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella paratyphi A (strain AKU_12601) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|Q5PMU5|RIBB_SALPA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ribB PE=3 SV=1 70 251 2.0E-52
sp|B7LQC3|RIBB_ESCF3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=ribB PE=3 SV=1 70 253 2.0E-52
sp|C5D3N0|RIBBA_GEOSW Riboflavin biosynthesis protein RibBA OS=Geobacillus sp. (strain WCH70) GN=ribBA PE=3 SV=1 70 254 3.0E-52
sp|A8APS7|RIBB_CITK8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=ribB PE=3 SV=1 70 253 3.0E-52
sp|P57940|RIBB_PASMU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pasteurella multocida (strain Pm70) GN=ribB PE=3 SV=1 76 262 4.0E-52
sp|A9MPW6|RIBB_SALAR 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ribB PE=3 SV=1 70 251 5.0E-52
sp|B4EW41|RIBB_PROMH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Proteus mirabilis (strain HI4320) GN=ribB PE=3 SV=1 70 253 1.0E-51
sp|C6D9P9|RIBB_PECCP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=ribB PE=3 SV=1 71 253 2.0E-51
sp|B2VGK1|RIBB_ERWT9 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ribB PE=3 SV=1 73 251 2.0E-51
sp|Q6D8S3|RIBB_PECAS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ribB PE=3 SV=1 71 253 2.0E-51
sp|Q0AXM5|RIBBA_SYNWW Riboflavin biosynthesis protein RibBA OS=Syntrophomonas wolfei subsp. wolfei (strain DSM 2245B / Goettingen) GN=ribBA PE=3 SV=1 70 251 3.0E-51
sp|Q7VQQ4|RIBB_BLOFL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Blochmannia floridanus GN=ribB PE=3 SV=1 76 254 3.0E-51
sp|Q3A668|RIBB_PELCD 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=ribB PE=3 SV=1 76 253 5.0E-51
sp|Q7N0C8|RIBB_PHOLL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ribB PE=3 SV=1 69 251 7.0E-51
sp|A1JQV2|RIBB_YERE8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|B1JM30|RIBB_YERPY 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|Q665V6|RIBB_YERPS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|A4THU2|RIBB_YERPP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pestis (strain Pestoides F) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|Q1CMD1|RIBB_YERPN 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|A9R7D2|RIBB_YERPG 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|Q8ZI56|RIBB_YERPE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pestis GN=ribB PE=1 SV=1 71 251 8.0E-51
sp|B2K2H0|RIBB_YERPB 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|Q1C377|RIBB_YERPA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|A7FE82|RIBB_YERP3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ribB PE=3 SV=1 71 251 8.0E-51
sp|O24752|RIBBA_CORAM Riboflavin biosynthesis protein RibBA OS=Corynebacterium ammoniagenes GN=ribBA PE=3 SV=1 62 252 9.0E-51
sp|B1KNY2|RIBB_SHEWM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=ribB PE=3 SV=1 69 253 2.0E-50
sp|Q1LSL6|RIBB_BAUCH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Baumannia cicadellinicola subsp. Homalodisca coagulata GN=ribB PE=3 SV=1 76 253 2.0E-50
sp|B7VT10|RIBB_VIBTL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio tasmaniensis (strain LGP32) GN=ribB PE=3 SV=1 76 250 2.0E-50
sp|Q8D2W5|RIBB_WIGBR 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Wigglesworthia glossinidia brevipalpis GN=ribB PE=3 SV=1 73 254 3.0E-50
sp|B8FLF4|RIBB_DESAA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=ribB PE=3 SV=1 71 253 3.0E-50
sp|Q6AQE3|RIBB_DESPS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfotalea psychrophila (strain LSv54 / DSM 12343) GN=ribB PE=3 SV=1 73 253 4.0E-50
sp|A5F159|RIBB_VIBC3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=ribB PE=3 SV=1 73 250 7.0E-50
sp|Q0I0H0|RIBB_SHESR 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella sp. (strain MR-7) GN=ribB PE=3 SV=1 69 250 9.0E-50
sp|Q0HP01|RIBB_SHESM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella sp. (strain MR-4) GN=ribB PE=3 SV=1 69 250 9.0E-50
sp|A3Q8W5|RIBB_SHELP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=ribB PE=3 SV=1 76 253 9.0E-50
sp|Q64YT3|RIBBA_BACFR Riboflavin biosynthesis protein RibBA OS=Bacteroides fragilis (strain YCH46) GN=ribBA PE=3 SV=1 68 254 1.0E-49
sp|Q5LHT1|RIBBA_BACFN Riboflavin biosynthesis protein RibBA OS=Bacteroides fragilis (strain ATCC 25285 / DSM 2151 / JCM 11019 / NCTC 9343) GN=ribBA PE=3 SV=1 68 254 1.0E-49
sp|A0KRF9|RIBB_SHESA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella sp. (strain ANA-3) GN=ribB PE=3 SV=1 62 250 1.0E-49
sp|Q65W81|RIBB_MANSM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=ribB PE=3 SV=1 69 265 1.0E-49
sp|Q7MWK9|RIBBA_PORGI Riboflavin biosynthesis protein RibBA OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=ribBA PE=3 SV=1 68 243 1.0E-49
sp|B2RIG7|RIBBA_PORG3 Riboflavin biosynthesis protein RibBA OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=ribBA PE=3 SV=1 68 243 1.0E-49
sp|A4J2L3|RIBB_DESRM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfotomaculum reducens (strain MI-1) GN=ribB PE=3 SV=1 70 253 2.0E-49
sp|Q9PHU4|RIBB_CAMJE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=ribB PE=3 SV=1 69 253 2.0E-49
sp|Q8A528|RIBBA_BACTN Riboflavin biosynthesis protein RibBA OS=Bacteroides thetaiotaomicron (strain ATCC 29148 / DSM 2079 / NCTC 10582 / E50 / VPI-5482) GN=ribBA PE=3 SV=1 68 252 2.0E-49
sp|B0UX44|RIBB_HISS2 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Histophilus somni (strain 2336) GN=ribB PE=3 SV=1 69 254 3.0E-49
sp|A0KHV1|RIBB_AERHH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=ribB PE=3 SV=1 86 250 4.0E-49
sp|A2SQG6|RIBB_METLZ 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Methanocorpusculum labreanum (strain ATCC 43576 / DSM 4855 / Z) GN=ribB PE=3 SV=1 68 254 6.0E-49
sp|Q9Z734|RIBBA_CHLPN Riboflavin biosynthesis protein RibBA OS=Chlamydia pneumoniae GN=ribBA PE=3 SV=1 69 253 6.0E-49
sp|Q2NWD7|RIBB_SODGM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Sodalis glossinidius (strain morsitans) GN=ribB PE=3 SV=1 76 253 8.0E-49
sp|Q3IKS6|RIBB_PSEHT 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ribB PE=3 SV=1 76 253 1.0E-48
sp|Q0I132|RIBB_HAES1 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Haemophilus somnus (strain 129Pt) GN=ribB PE=3 SV=1 69 254 1.0E-48
sp|A1RPZ7|RIBB_SHESW 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella sp. (strain W3-18-1) GN=ribB PE=3 SV=1 62 250 1.0E-48
sp|A8G1K1|RIBB_SHESH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella sediminis (strain HAW-EB3) GN=ribB PE=3 SV=1 69 253 1.0E-48
sp|A4Y1N7|RIBB_SHEPC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ribB PE=3 SV=1 62 251 1.0E-48
sp|A4SKH7|RIBB_AERS4 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Aeromonas salmonicida (strain A449) GN=ribB PE=3 SV=1 86 250 2.0E-48
sp|C3LWX2|RIBB_VIBCM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=ribB PE=3 SV=1 73 250 2.0E-48
sp|Q9KKP2|RIBB_VIBCH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=ribB PE=1 SV=1 73 250 2.0E-48
sp|Q7MFR0|RIBB_VIBVY 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio vulnificus (strain YJ016) GN=ribB PE=3 SV=1 73 253 2.0E-48
sp|Q8D485|RIBB_VIBVU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio vulnificus (strain CMCP6) GN=ribB PE=3 SV=1 73 253 2.0E-48
sp|Q7M936|RIBB_WOLSU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=ribB PE=3 SV=1 70 251 2.0E-48
sp|C6BVV4|RIBB_DESAD 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=ribB PE=3 SV=1 70 253 2.0E-48
sp|A1AKS6|RIBB_PELPD 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pelobacter propionicus (strain DSM 2379) GN=ribB PE=3 SV=1 68 253 4.0E-48
sp|A6WHL6|RIBB_SHEB8 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella baltica (strain OS185) GN=ribB PE=3 SV=1 62 250 6.0E-48
sp|A3DAC1|RIBB_SHEB5 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ribB PE=3 SV=1 62 250 6.0E-48
sp|Q8CWF6|RIBB_OCEIH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=ribB PE=3 SV=1 72 254 6.0E-48
sp|C4K8P2|RIBB_HAMD5 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=ribB PE=3 SV=1 69 253 6.0E-48
sp|A9KVB7|RIBB_SHEB9 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella baltica (strain OS195) GN=ribB PE=3 SV=1 62 250 8.0E-48
sp|B8E3W7|RIBB_SHEB2 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella baltica (strain OS223) GN=ribB PE=3 SV=1 62 250 8.0E-48
sp|P74104|RIBBA_SYNY3 Riboflavin biosynthesis protein RibBA OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=ribBA PE=3 SV=1 70 254 8.0E-48
sp|Q07WC1|RIBB_SHEFN 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella frigidimarina (strain NCIMB 400) GN=ribB PE=3 SV=1 76 250 9.0E-48
sp|A6KWQ7|RIBBA_BACV8 Riboflavin biosynthesis protein RibBA OS=Bacteroides vulgatus (strain ATCC 8482 / DSM 1447 / NCTC 11154) GN=ribBA PE=3 SV=1 68 254 1.0E-47
sp|Q7VJN5|RIBB_HELHP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=ribB PE=3 SV=1 73 246 1.0E-47
sp|Q9JZ77|RIBB_NEIMB 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ribB PE=3 SV=1 75 253 1.0E-47
sp|Q87GR5|RIBB_VIBPA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=ribB PE=3 SV=1 73 250 1.0E-47
sp|Q9JU97|RIBB_NEIMA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ribB PE=3 SV=1 75 253 2.0E-47
sp|B8CH19|RIBB_SHEPW 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=ribB PE=3 SV=1 69 253 2.0E-47
sp|A7GSD5|RIBBA_BACCN Riboflavin biosynthesis protein RibBA OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=ribBA PE=3 SV=1 70 254 3.0E-47
sp|Q8EKF2|RIBB_SHEON 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella oneidensis (strain MR-1) GN=ribB PE=3 SV=1 62 250 3.0E-47
sp|Q7W2M1|RIBB_BORPA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ribB PE=3 SV=1 73 243 3.0E-47
sp|Q7WDL7|RIBB_BORBR 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ribB PE=3 SV=1 73 243 3.0E-47
sp|A9VG50|RIBBA_BACWK Riboflavin biosynthesis protein RibBA OS=Bacillus weihenstephanensis (strain KBAB4) GN=ribBA PE=3 SV=1 70 254 3.0E-47
sp|Q731I5|RIBBA_BACC1 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=ribBA PE=3 SV=1 70 254 3.0E-47
sp|Q7VSF4|RIBB_BORPE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ribB PE=3 SV=1 73 243 4.0E-47
sp|B9IWX4|RIBBA_BACCQ Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain Q1) GN=ribBA PE=3 SV=1 70 254 4.0E-47
sp|B7HNM8|RIBBA_BACC7 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain AH187) GN=ribBA PE=3 SV=1 70 254 4.0E-47
sp|A8GYS3|RIBB_SHEPA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ribB PE=3 SV=1 70 253 4.0E-47
sp|B0TMY9|RIBB_SHEHH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ribB PE=3 SV=1 69 253 5.0E-47
sp|P16448|RIBB_VIBHA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Vibrio harveyi GN=ribB PE=3 SV=1 73 253 5.0E-47
sp|Q635H0|RIBBA_BACCZ Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ZK / E33L) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|Q6HE54|RIBBA_BACHK Riboflavin biosynthesis protein RibBA OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|C1EQY5|RIBBA_BACC3 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain 03BB102) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|Q81MB6|RIBBA_BACAN Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|A0RIB3|RIBBA_BACAH Riboflavin biosynthesis protein RibBA OS=Bacillus thuringiensis (strain Al Hakam) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|C3LIX7|RIBBA_BACAC Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|C3P7P7|RIBBA_BACAA Riboflavin biosynthesis protein RibBA OS=Bacillus anthracis (strain A0248) GN=ribBA PE=3 SV=1 70 254 8.0E-47
sp|B3EEP4|RIBB_CHLL2 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Chlorobium limicola (strain DSM 245 / NBRC 103803) GN=ribB PE=3 SV=1 63 251 8.0E-47
sp|B7IWM5|RIBBA_BACC2 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain G9842) GN=ribBA PE=3 SV=1 70 254 9.0E-47
sp|B7HAY4|RIBBA_BACC4 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain B4264) GN=ribBA PE=3 SV=1 70 254 9.0E-47
sp|Q818X6|RIBBA_BACCR Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=ribBA PE=3 SV=1 70 254 9.0E-47
sp|Q8NW14|RIBBA_STAAW Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MW2) GN=ribBA PE=3 SV=1 69 253 9.0E-47
sp|Q6G8G1|RIBBA_STAAS Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MSSA476) GN=ribBA PE=3 SV=1 69 253 9.0E-47
sp|Q6GFT5|RIBBA_STAAR Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain MRSA252) GN=ribBA PE=3 SV=1 69 253 9.0E-47
sp|A6LHN0|RIBBA_PARD8 Riboflavin biosynthesis protein RibBA OS=Parabacteroides distasonis (strain ATCC 8503 / DSM 20701 / NCTC 11152) GN=ribBA PE=3 SV=1 66 243 1.0E-46
sp|Q7A511|RIBBA_STAAN Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain N315) GN=ribBA PE=3 SV=1 69 253 1.0E-46
sp|Q99TA0|RIBBA_STAAM Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=ribBA PE=3 SV=1 69 253 1.0E-46
sp|B8D6X1|RIBB_BUCAT 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain Tuc7) GN=ribB PE=3 SV=1 70 252 1.0E-46
sp|P57167|RIBB_BUCAI 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain APS) GN=ribB PE=3 SV=1 70 252 1.0E-46
sp|B8D8L7|RIBB_BUCA5 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Buchnera aphidicola subsp. Acyrthosiphon pisum (strain 5A) GN=ribB PE=3 SV=1 70 252 1.0E-46
sp|Q9PLJ5|RIBBA_CHLMU Riboflavin biosynthesis protein RibBA OS=Chlamydia muridarum (strain MoPn / Nigg) GN=ribBA PE=3 SV=1 72 253 2.0E-46
sp|Q5HF07|RIBBA_STAAC Riboflavin biosynthesis protein RibBA OS=Staphylococcus aureus (strain COL) GN=ribBA PE=3 SV=1 69 253 2.0E-46
sp|A7Z675|RIBBA_BACMF Riboflavin biosynthesis protein RibBA OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=ribBA PE=3 SV=1 70 253 2.0E-46
sp|Q6LIW0|RIBB_PHOPR 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Photobacterium profundum GN=ribB PE=3 SV=1 69 254 2.0E-46
sp|B7JLW6|RIBBA_BACC0 Riboflavin biosynthesis protein RibBA OS=Bacillus cereus (strain AH820) GN=ribBA PE=3 SV=1 70 254 3.0E-46
sp|Q11WK6|RIBBA_CYTH3 Riboflavin biosynthesis protein RibBA OS=Cytophaga hutchinsonii (strain ATCC 33406 / NCIMB 9469) GN=ribBA PE=3 SV=1 68 254 3.0E-46
sp|Q8CNU2|RIBBA_STAES Riboflavin biosynthesis protein RibBA OS=Staphylococcus epidermidis (strain ATCC 12228) GN=ribBA PE=3 SV=1 69 253 4.0E-46
sp|Q8KA55|RIBB_BUCAP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Buchnera aphidicola subsp. Schizaphis graminum (strain Sg) GN=ribB PE=3 SV=1 70 251 4.0E-46
sp|C0QJB0|RIBB_DESAH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfobacterium autotrophicum (strain ATCC 43914 / DSM 3382 / HRM2) GN=ribB PE=3 SV=1 70 252 4.0E-46
sp|Q9L6K8|RIBB_ALIFS 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Aliivibrio fischeri GN=ribB PE=3 SV=1 70 253 5.0E-46
sp|Q5HNE3|RIBBA_STAEQ Riboflavin biosynthesis protein RibBA OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=ribBA PE=3 SV=1 69 253 9.0E-46
sp|Q882G0|RIBB_PSESM 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ribB PE=3 SV=1 68 253 2.0E-45
sp|B3QWA4|RIBB_CHLT3 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Chloroherpeton thalassium (strain ATCC 35110 / GB-78) GN=ribB PE=3 SV=1 64 253 3.0E-45
sp|P50855|RIBBA_ACTPL Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae GN=ribBA PE=3 SV=1 66 251 4.0E-45
sp|A3MZA2|RIBBA_ACTP2 Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ribBA PE=3 SV=1 66 251 4.0E-45
sp|O84736|RIBBA_CHLTR Riboflavin biosynthesis protein RibBA OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=ribBA PE=3 SV=1 72 253 5.0E-45
sp|Q5WH08|RIBBA_BACSK Riboflavin biosynthesis protein RibBA OS=Bacillus clausii (strain KSM-K16) GN=ribBA PE=3 SV=1 70 253 8.0E-45
sp|A7GHE0|RIBB_CLOBL 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Clostridium botulinum (strain Langeland / NCTC 10281 / Type F) GN=ribB PE=3 SV=1 69 253 1.0E-44
sp|P17620|RIBBA_BACSU Riboflavin biosynthesis protein RibBA OS=Bacillus subtilis (strain 168) GN=ribBA PE=3 SV=1 70 243 1.0E-44
sp|Q3B2I6|RIBBA_CHLL7 Riboflavin biosynthesis protein RibBA OS=Chlorobium luteolum (strain DSM 273 / 2530) GN=ribBA PE=3 SV=1 68 254 1.0E-44
sp|B3H0P8|RIBBA_ACTP7 Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ribBA PE=3 SV=1 66 251 1.0E-44
sp|P51962|RIBB_PHOPO 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Photobacterium phosphoreum GN=ribB PE=3 SV=1 68 253 2.0E-44
sp|Q313P5|RIBB_DESAG 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfovibrio alaskensis (strain G20) GN=ribB PE=3 SV=1 76 243 2.0E-44
sp|A4SFY4|RIBBA_CHLPM Riboflavin biosynthesis protein RibBA OS=Chlorobium phaeovibrioides (strain DSM 265 / 1930) GN=ribBA PE=3 SV=1 70 254 4.0E-44
sp|P51695|RIBBA_BACAM Riboflavin biosynthesis protein RibBA OS=Bacillus amyloliquefaciens GN=ribBA PE=3 SV=1 70 243 5.0E-44
sp|P59556|RIBB_BUCBP 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Buchnera aphidicola subsp. Baizongia pistaciae (strain Bp) GN=ribB PE=3 SV=1 73 251 7.0E-44
sp|Q2RS98|RIBB_RHORT 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Rhodospirillum rubrum (strain ATCC 11170 / ATH 1.1.1 / DSM 467 / LMG 4362 / NCIB 8255 / S1) GN=ribB PE=3 SV=1 71 243 8.0E-44
sp|A5I603|RIBB_CLOBH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Clostridium botulinum (strain Hall / ATCC 3502 / NCTC 13319 / Type A) GN=ribB PE=3 SV=1 69 253 8.0E-44
sp|A7FXH7|RIBB_CLOB1 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Clostridium botulinum (strain ATCC 19397 / Type A) GN=ribB PE=3 SV=1 69 253 8.0E-44
sp|B8J4Q5|RIBB_DESDA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfovibrio desulfuricans (strain ATCC 27774 / DSM 6949) GN=ribB PE=3 SV=1 71 259 9.0E-44
sp|Q72B63|RIBB_DESVH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=ribB PE=3 SV=1 71 253 2.0E-43
sp|Q7NQC4|RIBB_CHRVO 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ribB PE=3 SV=1 76 253 2.0E-43
sp|A1VD83|RIBB_DESVV 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=ribB PE=3 SV=1 71 253 3.0E-43
sp|Q8XQN1|RIBB_RALSO 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Ralstonia solanacearum (strain GMI1000) GN=ribB PE=3 SV=1 77 253 4.0E-43
sp|O68249|RIBB_SULMU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Sulfurospirillum multivorans GN=ribB PE=3 SV=1 73 250 4.0E-43
sp|Q02008|RIBB_PHOLE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Photobacterium leiognathi GN=ribB PE=3 SV=1 68 253 4.0E-43
sp|Q46TZ9|RIBB_CUPPJ 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=ribB PE=3 SV=1 73 254 4.0E-43
sp|B0BTN8|RIBBA_ACTPJ Riboflavin biosynthesis protein RibBA OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=ribBA PE=3 SV=1 66 251 5.0E-43
sp|Q49YJ7|RIBBA_STAS1 Riboflavin biosynthesis protein RibBA OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=ribBA PE=3 SV=1 68 252 7.0E-42
sp|C0ZKW2|RIBBA_BREBN Riboflavin biosynthesis protein RibBA OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=ribBA PE=3 SV=1 70 254 8.0E-42
sp|Q9HWX4|RIBB_PSEAE 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ribB PE=3 SV=1 68 251 7.0E-41
sp|Q4L7B1|RIBBA_STAHJ Riboflavin biosynthesis protein RibBA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=ribBA PE=3 SV=1 68 250 7.0E-41
sp|Q6L506|RIBA3_ORYSJ Probable monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic OS=Oryza sativa subsp. japonica GN=RIBA3 PE=2 SV=1 27 242 9.0E-40
sp|B4S5Y8|RIBBA_PROA2 Riboflavin biosynthesis protein RibBA OS=Prosthecochloris aestuarii (strain DSM 271 / SK 413) GN=ribBA PE=3 SV=1 69 254 2.0E-38
sp|Q9FN89|RIBA3_ARATH Monofunctional riboflavin biosynthesis protein RIBA 3, chloroplastic OS=Arabidopsis thaliana GN=RIBA3 PE=1 SV=1 70 242 6.0E-37
sp|Q88QG4|RIBB_PSEPK 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Pseudomonas putida (strain KT2440) GN=ribB PE=3 SV=1 70 254 3.0E-36
sp|B4SE30|RIBBA_PELPB Riboflavin biosynthesis protein RibBA OS=Pelodictyon phaeoclathratiforme (strain DSM 5477 / BU-1) GN=ribBA PE=3 SV=1 69 243 3.0E-36
sp|Q60364|RIBB_METJA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=ribB PE=1 SV=1 71 253 6.0E-24
sp|O27543|RIBB_METTH 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=ribB PE=3 SV=1 73 245 1.0E-21
sp|Q8PW86|RIBB_METMA 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=ribB PE=3 SV=1 68 236 2.0E-18
sp|Q8TT89|RIBB_METAC 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=ribB PE=3 SV=1 68 236 4.0E-17
sp|Q9X2E6|RIBBA_THEMA Riboflavin biosynthesis protein RibBA OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=ribBA PE=3 SV=1 73 235 4.0E-14
sp|O28173|RIBB_ARCFU 3,4-dihydroxy-2-butanone 4-phosphate synthase OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=ribB PE=3 SV=1 73 234 2.0E-11
[Show less]

GO

GO Term Description Terminal node
GO:0009231 riboflavin biosynthetic process Yes
GO:0008686 3,4-dihydroxy-2-butanone-4-phosphate synthase activity Yes
GO:0042727 flavin-containing compound biosynthetic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0008152 metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0044281 small molecule metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0071704 organic substance metabolic process No
GO:0016830 carbon-carbon lyase activity No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0009058 biosynthetic process No
GO:0042364 water-soluble vitamin biosynthetic process No
GO:0044283 small molecule biosynthetic process No
GO:0042726 flavin-containing compound metabolic process No
GO:0006771 riboflavin metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0016829 lyase activity No
GO:0003674 molecular_function No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0009110 vitamin biosynthetic process No
GO:0006766 vitamin metabolic process No
GO:0009987 cellular process No
GO:0006767 water-soluble vitamin metabolic process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 62 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|093130
MSPVAVAHNPVSLGGSTSPHIHKHGFNTNSPIISSSSVPSTTTTSPPPQTNQQTWRPKQVEAPKRTAFSFDSMSE
ALEAFTNGEFLVVMDDENRENEGDLIISGSQCTPEKMAWMIKYTSGYICCALPGSRLAELDIPMMVPDNQDRHKT
AYTVTVDYKHGTTTGISAHDRSLTVRSLASPTTLSSDFARPGHMVPLRAREGGVLTRKGHTEASVDLCLLTHQSQ
AGVLCELVNDDVMGSMARRDDCRAFADRWVGYLCETIVGL*
Coding >AgabiH97|093130
ATGTCTCCAGTCGCCGTCGCACACAACCCAGTCTCCCTCGGCGGCAGCACATCCCCCCATATTCACAAACACGGT
TTCAATACAAATTCCCCTATAATCTCTAGCTCCTCTGTCCCTTCTACGACCACAACTTCTCCTCCTCCTCAGACG
AACCAACAAACATGGCGTCCTAAACAAGTCGAAGCACCCAAACGAACCGCTTTCTCATTCGATTCCATGTCCGAA
GCTTTAGAGGCTTTCACAAATGGTGAATTCCTCGTTGTGATGGACGATGAGAATCGAGAGAATGAAGGTGATCTT
ATCATCTCTGGTAGTCAATGTACGCCGGAGAAGATGGCTTGGATGATCAAATATACCAGTGGATATATCTGTTGT
GCCCTCCCCGGTTCCCGATTAGCCGAACTCGACATCCCAATGATGGTCCCAGACAACCAAGACCGTCACAAAACA
GCCTACACCGTCACCGTCGACTACAAACACGGCACTACAACCGGAATATCCGCACACGACCGTTCTTTAACCGTC
CGTTCCCTCGCCTCACCCACAACTCTCTCATCCGATTTCGCACGTCCAGGCCACATGGTCCCTCTCCGTGCTCGT
GAAGGTGGCGTACTTACACGTAAAGGTCATACCGAAGCCAGTGTCGATCTTTGTCTTTTGACACATCAATCTCAA
GCTGGTGTGTTGTGTGAATTGGTGAATGATGATGTGATGGGGAGTATGGCGAGGAGAGATGATTGTCGTGCTTTT
GCTGATCGTTGGGTAGGATATTTGTGTGAAACAATCGTCGGATTGTAG
Transcript >AgabiH97|093130
ATGTCTCCAGTCGCCGTCGCACACAACCCAGTCTCCCTCGGCGGCAGCACATCCCCCCATATTCACAAACACGGT
TTCAATACAAATTCCCCTATAATCTCTAGCTCCTCTGTCCCTTCTACGACCACAACTTCTCCTCCTCCTCAGACG
AACCAACAAACATGGCGTCCTAAACAAGTCGAAGCACCCAAACGAACCGCTTTCTCATTCGATTCCATGTCCGAA
GCTTTAGAGGCTTTCACAAATGGTGAATTCCTCGTTGTGATGGACGATGAGAATCGAGAGAATGAAGGTGATCTT
ATCATCTCTGGTAGTCAATGTACGCCGGAGAAGATGGCTTGGATGATCAAATATACCAGTGGATATATCTGTTGT
GCCCTCCCCGGTTCCCGATTAGCCGAACTCGACATCCCAATGATGGTCCCAGACAACCAAGACCGTCACAAAACA
GCCTACACCGTCACCGTCGACTACAAACACGGCACTACAACCGGAATATCCGCACACGACCGTTCTTTAACCGTC
CGTTCCCTCGCCTCACCCACAACTCTCTCATCCGATTTCGCACGTCCAGGCCACATGGTCCCTCTCCGTGCTCGT
GAAGGTGGCGTACTTACACGTAAAGGTCATACCGAAGCCAGTGTCGATCTTTGTCTTTTGACACATCAATCTCAA
GCTGGTGTGTTGTGTGAATTGGTGAATGATGATGTGATGGGGAGTATGGCGAGGAGAGATGATTGTCGTGCTTTT
GCTGATCGTTGGGTAGGATATTTGTGTGAAACAATCGTCGGATTGTAG
Gene >AgabiH97|093130
ATGTCTCCAGTCGCCGTCGCACACAACCCAGTCTCCCTCGGCGGCAGCACATCCCCCCATATTCACAAACACGGT
TTCAATACAAATTCCCCTATAATCTCTAGCTCCTCTGTCCCTTCTACGACCACAACTTCTCCTCCTCCTCAGACG
AACCAACAAACATGGCGTCCTAAACAAGTCGAAGCACCCAAACGAACCGCTTTCTCATTCGATTCCATGTCCGAA
GCTTTAGAGGCTTTCACAAATGGTGAATTCCTCGTTGTGATGGACGATGAGAATCGAGAGAATGAAGGTGATCTT
ATCATCTCTGGTAGTCAATGTACGCCGGAGAAGATGGCTTGGATGATCAAATATACCAGGTACGTTAAAACTTTT
TCTTACCACCACAGTCTTCTTTTCTTCTTCTTCTTTCTCTACCTACCCGCTTTATGATTCATTGTTACCCTCGGT
TATTCGGTTCCCGTCTTAGTCAAGCAATTTAATCATGTGCACAATGCACCCATACCACATATCATTTTCAAGCCC
CCAAATGCAATTACGTTATTTACTAATTAATTCTTTCAGTGGATATATCTGTTGTGCCCTCCCCGGTTCCCGATT
AGCCGAACTCGACATCCCAATGATGGTCCCAGACAACCAAGACCGTCACAAAACAGCCTACACCGTCACCGTCGA
CTACAAACACGGCACTACAACCGGAATATCCGCACACGACCGTTCTTTAACCGTCCGTTCCCTCGCCTCACCCAC
AACTCTCTCATCCGATTTCGCACGTCCAGGCCACATGGTCCCTCTCCGTGCTCGTGAAGGTGGCGTACTTACACG
TAAAGGTCATACCGAAGCCAGTGTCGATCTTTGTCTTTTGACACATCAATCTCAAGCTGGTGTGTTGTGTGAATT
GGTGAATGATGATGTGATGGGGAGTATGGCGAGGAGAGATGATTGTCGTGCTTTTGCTGATCGTTGGGGTTTGAA
AATGATTAGTGTGGATATGATTGCGGAGTATAAGAGGGATGTTTGGTCGTCTCAGTAGGATATTTGTGTGAAACG
TATGTTTGTTTATCATCTACATAGCAAGATCTTACATGTTTTGTTAGAATCGTCGGATTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail