Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092990
Gene name
Locationscaffold_6:1241141..1242090
Strand-
Gene length (bp)949
Transcript length (bp)729
Coding sequence length (bp)729
Protein length (aa) 243

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01569 PAP2 PAP2 superfamily 1.2E-11 84 171

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2M6|DOPP_NEUCR Putative dolichyldiphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.220 PE=3 SV=1 7 232 9.0E-26
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 9 240 5.0E-25
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 9 240 3.0E-24
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 9 166 2.0E-23
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 9 240 3.0E-23
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9C2M6|DOPP_NEUCR Putative dolichyldiphosphatase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=17E5.220 PE=3 SV=1 7 232 9.0E-26
sp|B2KI79|DOPP1_RHIFE Dolichyldiphosphatase 1 OS=Rhinolophus ferrumequinum GN=DOLPP1 PE=3 SV=1 9 240 5.0E-25
sp|Q9JMF7|DOPP1_MOUSE Dolichyldiphosphatase 1 OS=Mus musculus GN=Dolpp1 PE=2 SV=1 9 240 3.0E-24
sp|P53223|CAX4_YEAST Dolichyldiphosphatase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CAX4 PE=1 SV=1 9 166 2.0E-23
sp|Q86YN1|DOPP1_HUMAN Dolichyldiphosphatase 1 OS=Homo sapiens GN=DOLPP1 PE=2 SV=1 9 240 3.0E-23
sp|B0CM95|DOPP1_PAPAN Dolichyldiphosphatase 1 OS=Papio anubis GN=DOLPP1 PE=3 SV=1 9 240 4.0E-23
sp|B0KWE9|DOPP1_CALJA Dolichyldiphosphatase 1 OS=Callithrix jacchus GN=DOLPP1 PE=3 SV=1 9 240 5.0E-23
sp|B1MTH4|DOPP1_CALMO Dolichyldiphosphatase 1 OS=Callicebus moloch GN=DOLPP1 PE=3 SV=1 9 240 2.0E-22
sp|Q86IX2|DOPP1_DICDI Dolichyldiphosphatase 1 OS=Dictyostelium discoideum GN=dolpp1 PE=3 SV=1 7 209 1.0E-20
sp|O59747|PDF1_SCHPO Palmitoyl-protein thioesterase-dolichyl pyrophosphate phosphatase fusion 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pdf1 PE=1 SV=2 11 175 3.0E-14
sp|Q6NLA5|LPPG_ARATH Lipid phosphate phosphatase gamma, chloroplastic OS=Arabidopsis thaliana GN=LPPG PE=1 SV=1 5 205 7.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.5

Transmembrane Domains

Domain # Start End Length
1 21 43 22
2 95 114 19
3 127 144 17
4 154 176 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092990
MSEGQKTSLDLTHVLYNDDSILSLGLALITLSPILLMASYAALAVMTREYLVIVMWTGQLFGEALNYAIKHAIKQ
DRPIQSIGNGYGFPSSHSQYMGYFATFLICHMYFRHRFASTGWKPIDQLWRLVVYVGLLCWAGAVAYSRHYLEYH
NWHQISWGLGIGSSLGFSIYLACELIPTKYPTSFLSQVKLFVLENPVSTWLQIRDGWAIWSDGGREVEWQRWRAE
WEKQKKAGQLKRGTKRL*
Coding >AgabiH97|092990
ATGTCAGAAGGCCAGAAGACGTCACTCGACCTCACCCACGTACTCTACAATGACGATTCTATACTTTCGCTCGGG
CTTGCCTTGATCACATTGAGTCCAATTTTACTTATGGCCTCATATGCGGCGTTGGCTGTGATGACACGCGAATAC
CTTGTCATTGTAATGTGGACTGGGCAGCTATTTGGTGAAGCATTGAACTACGCTATAAAACATGCCATAAAACAA
GATCGACCAATTCAAAGCATTGGCAATGGCTATGGGTTTCCGTCTTCACACAGCCAATACATGGGATATTTTGCA
ACCTTTCTGATTTGCCACATGTATTTCAGGCATCGCTTTGCCAGCACAGGTTGGAAACCAATAGATCAGCTATGG
CGTCTTGTGGTCTATGTCGGTCTGTTATGCTGGGCTGGCGCAGTTGCGTATTCAAGGCACTATCTTGAATACCAC
AACTGGCATCAGATATCATGGGGTCTGGGTATCGGGTCTTCCTTGGGTTTCTCGATTTACCTCGCTTGTGAATTG
ATTCCGACGAAATATCCAACATCGTTCCTAAGCCAAGTCAAATTGTTTGTGTTGGAGAATCCTGTGTCTACCTGG
CTTCAGATTCGTGACGGTTGGGCGATCTGGTCTGACGGAGGGAGAGAAGTCGAGTGGCAGCGTTGGCGGGCGGAA
TGGGAGAAGCAGAAAAAAGCAGGACAGCTGAAAAGGGGAACTAAGCGCCTGTAG
Transcript >AgabiH97|092990
ATGTCAGAAGGCCAGAAGACGTCACTCGACCTCACCCACGTACTCTACAATGACGATTCTATACTTTCGCTCGGG
CTTGCCTTGATCACATTGAGTCCAATTTTACTTATGGCCTCATATGCGGCGTTGGCTGTGATGACACGCGAATAC
CTTGTCATTGTAATGTGGACTGGGCAGCTATTTGGTGAAGCATTGAACTACGCTATAAAACATGCCATAAAACAA
GATCGACCAATTCAAAGCATTGGCAATGGCTATGGGTTTCCGTCTTCACACAGCCAATACATGGGATATTTTGCA
ACCTTTCTGATTTGCCACATGTATTTCAGGCATCGCTTTGCCAGCACAGGTTGGAAACCAATAGATCAGCTATGG
CGTCTTGTGGTCTATGTCGGTCTGTTATGCTGGGCTGGCGCAGTTGCGTATTCAAGGCACTATCTTGAATACCAC
AACTGGCATCAGATATCATGGGGTCTGGGTATCGGGTCTTCCTTGGGTTTCTCGATTTACCTCGCTTGTGAATTG
ATTCCGACGAAATATCCAACATCGTTCCTAAGCCAAGTCAAATTGTTTGTGTTGGAGAATCCTGTGTCTACCTGG
CTTCAGATTCGTGACGGTTGGGCGATCTGGTCTGACGGAGGGAGAGAAGTCGAGTGGCAGCGTTGGCGGGCGGAA
TGGGAGAAGCAGAAAAAAGCAGGACAGCTGAAAAGGGGAACTAAGCGCCTGTAG
Gene >AgabiH97|092990
ATGTCAGAAGGCCAGAAGACGTCACTCGACCTCACCCACGTACTCTGCAAGTTCAGCGTGTCCTTAGACTTCCGA
ATGCTCACTCTAATAGACTTTCAGACAATGACGATTCTATACTTTCGCTCGGGCTTGCCTTGATCACATTGAGTC
CAATTTTACTTATGGTATGTGTAGCTATGGCTCTAGATTTGTAATACCTCTGAAGTGACATGACAGGCCTCATAT
GCGGCGTTGGCTGTGATGACACGCGAATACCTTGTCATTGTAATGTGGACTGGGCAGCTATTTGGTGAAGCATTG
AACTACGCTATAAAACATGCCATAAAACAAGATCGACCAATTCGTGAGTGCCAATGATGCCTTTGTATATCGCCT
GAACCCAATTCTGTACTTGTTCTAGAAAGCATTGGCAATGGCTATGGGTTTCCGTCTTCACACAGCCAATACATG
GGATATTTTGCAACCTTTCTGATTTGCCACATGTATTTCAGGCATCGCTTTGCCAGCACAGGTTGGAAACCAATA
GATCAGCTATGGCGTCTTGTGGTCTATGTCGGTCTGTTATGCTGGGCTGGCGCAGTTGCGTATTCAAGGTGAGGG
CAGCAGAACTCTATGCTGTAGAAGCGTTTCTGACAGTGAGTCATGACATAGGCACTATCTTGAATACCACAACTG
GCATCAGATATCATGGGGTCTGGGTATCGGGTCTTCCTTGGGTTTCTCGATTTACCTCGCTTGTGAATTGATTCC
GACGAAATATCCAACATCGTTCCTAAGCCAAGTCAAATTGTTTGTGTTGGAGAATCCTGTGTCTACCTGGCTTCA
GATTCGTGACGGTTGGGCGATCTGGTCTGACGGAGGGAGAGAAGTCGAGTGGCAGCGTTGGCGGGCGGAATGGGA
GAAGCAGAAAAAAGCAGGACAGCTGAAAAGGGGAACTAAGCGCCTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail