Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092440
Gene name
Locationscaffold_6:1108395..1109948
Strand-
Gene length (bp)1553
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08240 ADH_N Alcohol dehydrogenase GroES-like domain 4.8E-24 58 171
PF00107 ADH_zinc_N Zinc-binding dehydrogenase 4.0E-16 212 343

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q763T4|LAD_ASPOZ L-arabinitol 4-dehydrogenase OS=Aspergillus oryzae GN=ladA PE=1 SV=1 34 381 4.0E-126
sp|A2QAC0|LAD_ASPNC L-arabinitol 4-dehydrogenase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ladA PE=1 SV=1 34 381 9.0E-126
sp|C5J3R8|LAD_TALEM L-arabinitol 4-dehydrogenase OS=Talaromyces emersonii GN=lad PE=1 SV=1 35 381 1.0E-123
sp|Q7SI09|LAD_NEUCR L-arabinitol 4-dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ard-1 PE=1 SV=1 35 383 5.0E-121
sp|B6HI95|LAD_PENRW L-arabinitol 4-dehydrogenase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lad1 PE=1 SV=1 31 381 2.0E-119
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q763T4|LAD_ASPOZ L-arabinitol 4-dehydrogenase OS=Aspergillus oryzae GN=ladA PE=1 SV=1 34 381 4.0E-126
sp|A2QAC0|LAD_ASPNC L-arabinitol 4-dehydrogenase OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=ladA PE=1 SV=1 34 381 9.0E-126
sp|C5J3R8|LAD_TALEM L-arabinitol 4-dehydrogenase OS=Talaromyces emersonii GN=lad PE=1 SV=1 35 381 1.0E-123
sp|Q7SI09|LAD_NEUCR L-arabinitol 4-dehydrogenase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=ard-1 PE=1 SV=1 35 383 5.0E-121
sp|B6HI95|LAD_PENRW L-arabinitol 4-dehydrogenase OS=Penicillium rubens (strain ATCC 28089 / DSM 1075 / NRRL 1951 / Wisconsin 54-1255) GN=lad1 PE=1 SV=1 31 381 2.0E-119
sp|Q96V44|LAD_HYPJE L-arabinitol 4-dehydrogenase OS=Hypocrea jecorina GN=lad1 PE=1 SV=1 35 383 3.0E-118
sp|P0DMQ6|DHSO_CHICK Sorbitol dehydrogenase OS=Gallus gallus GN=SORD PE=1 SV=1 33 367 8.0E-100
sp|Q58D31|DHSO_BOVIN Sorbitol dehydrogenase OS=Bos taurus GN=SORD PE=2 SV=3 35 369 5.0E-99
sp|Q64442|DHSO_MOUSE Sorbitol dehydrogenase OS=Mus musculus GN=Sord PE=1 SV=3 30 369 2.0E-98
sp|Q00796|DHSO_HUMAN Sorbitol dehydrogenase OS=Homo sapiens GN=SORD PE=1 SV=4 35 368 5.0E-97
sp|P27867|DHSO_RAT Sorbitol dehydrogenase OS=Rattus norvegicus GN=Sord PE=1 SV=4 30 369 9.0E-96
sp|P07846|DHSO_SHEEP Sorbitol dehydrogenase OS=Ovis aries GN=SORD PE=1 SV=1 35 369 3.0E-95
sp|Q4R639|DHSO_MACFA Sorbitol dehydrogenase OS=Macaca fascicularis GN=SORD PE=2 SV=3 35 367 4.0E-94
sp|Q5R5F3|DHSO_PONAB Sorbitol dehydrogenase OS=Pongo abelii GN=SORD PE=2 SV=1 34 366 7.0E-94
sp|Q9FJ95|DHSO_ARATH Sorbitol dehydrogenase OS=Arabidopsis thaliana GN=SDH PE=1 SV=1 24 382 1.0E-77
sp|P35497|DHSO1_YEAST Sorbitol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR1 PE=3 SV=1 34 366 6.0E-73
sp|Q4WAU7|XYL2_ASPFU Probable D-xylulose reductase A OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=xdhA PE=3 SV=2 35 366 5.0E-72
sp|B0YC65|XYL2_ASPFC Probable D-xylulose reductase A OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=xdhA PE=3 SV=2 35 366 5.0E-72
sp|Q07786|DHSO2_YEAST Sorbitol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SOR2 PE=3 SV=1 34 366 5.0E-72
sp|A1D9C9|XYL2_NEOFI Probable D-xylulose reductase A OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=xdhA PE=3 SV=1 35 366 6.0E-72
sp|Q5GN51|XYL2_ASPNG D-xylulose reductase A OS=Aspergillus niger GN=xdhA PE=3 SV=1 35 367 6.0E-72
sp|A2QY54|XYL2_ASPNC Probable D-xylulose reductase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=xdhA PE=3 SV=1 35 367 6.0E-72
sp|Q1PSI9|IDND_VITVI L-idonate 5-dehydrogenase OS=Vitis vinifera GN=VIT_16s0100g00290 PE=1 SV=2 35 370 3.0E-71
sp|Q0CWQ2|XYL2_ASPTN Probable D-xylulose reductase A OS=Aspergillus terreus (strain NIH 2624 / FGSC A1156) GN=xdhA PE=3 SV=1 35 366 6.0E-71
sp|A1CFY8|XYL2_ASPCL Probable D-xylulose reductase A OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=xdhA PE=3 SV=2 35 366 9.0E-71
sp|Q86ZV0|XYL2_ASPOR D-xylulose reductase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=xdhA PE=3 SV=2 27 367 2.0E-70
sp|Q06004|DHSO_BACSU Sorbitol dehydrogenase OS=Bacillus subtilis (strain 168) GN=gutB PE=1 SV=3 31 381 6.0E-69
sp|Q5ARL6|XYL2_EMENI Probable D-xylulose reductase A OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xdhA PE=3 SV=1 35 366 8.0E-69
sp|P36624|DHSO_SCHPO Putative sorbitol dehydrogenase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tms1 PE=3 SV=2 60 381 2.0E-68
sp|C5FTT1|XYL2_ARTOC Probable D-xylulose reductase A OS=Arthroderma otae (strain ATCC MYA-4605 / CBS 113480) GN=xdhA PE=3 SV=1 60 367 5.0E-67
sp|Q02912|DHSO_BOMMO Sorbitol dehydrogenase OS=Bombyx mori GN=SDH PE=2 SV=1 35 383 1.0E-64
sp|Q92MT4|XYLD_RHIME Putative D-xylulose reductase OS=Rhizobium meliloti (strain 1021) GN=R02526 PE=3 SV=1 58 381 6.0E-64
sp|Q8U7Y1|XYLD_AGRFC Putative D-xylulose reductase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=Atu4318 PE=3 SV=1 57 381 2.0E-62
sp|P77280|YDJJ_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjJ OS=Escherichia coli (strain K12) GN=ydjJ PE=3 SV=1 46 383 3.0E-61
sp|Q07993|XYL2_YEAST D-xylulose reductase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=XYL2 PE=1 SV=1 58 367 3.0E-61
sp|Q59545|XYLD_MORMO D-xylulose reductase OS=Morganella morganii PE=1 SV=1 57 374 1.0E-59
sp|Q98D10|XYLD_RHILO Putative D-xylulose reductase OS=Rhizobium loti (strain MAFF303099) GN=mlr4915 PE=3 SV=1 57 381 2.0E-58
sp|P22144|XYL2_PICST D-xylulose reductase OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=XYL2 PE=2 SV=1 58 381 2.0E-56
sp|Q72L62|TDH_THET2 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=tdh PE=3 SV=1 42 371 7.0E-40
sp|Q5SKS4|TDH_THET8 L-threonine 3-dehydrogenase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=tdh PE=1 SV=1 42 371 8.0E-39
sp|Q8U259|TDH_PYRFU Probable L-threonine 3-dehydrogenase OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=tdh PE=3 SV=1 41 357 3.0E-38
sp|Q9UYX0|TDH_PYRAB Probable L-threonine 3-dehydrogenase OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=tdh PE=3 SV=1 41 357 3.0E-38
sp|A3QJC8|TDH_SHELP L-threonine 3-dehydrogenase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=tdh PE=3 SV=1 42 361 8.0E-38
sp|Q5JI69|TDH_THEKO Probable L-threonine 3-dehydrogenase OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=tdh PE=1 SV=1 41 364 1.0E-37
sp|O58389|TDH_PYRHO Probable L-threonine 3-dehydrogenase OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=tdh PE=1 SV=1 41 357 1.0E-37
sp|Q3IHW0|TDH_PSEHT L-threonine 3-dehydrogenase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=tdh PE=3 SV=1 46 377 9.0E-37
sp|B6YTJ5|TDH_THEON Probable L-threonine 3-dehydrogenase OS=Thermococcus onnurineus (strain NA1) GN=tdh PE=3 SV=1 41 364 1.0E-36
sp|A6WUG6|TDH_SHEB8 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS185) GN=tdh PE=3 SV=1 46 377 2.0E-36
sp|A1RE07|TDH_SHESW L-threonine 3-dehydrogenase OS=Shewanella sp. (strain W3-18-1) GN=tdh PE=3 SV=1 46 377 2.0E-36
sp|A9KWY0|TDH_SHEB9 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS195) GN=tdh PE=3 SV=1 46 377 2.0E-36
sp|A3CYN0|TDH_SHEB5 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=tdh PE=3 SV=1 46 377 2.0E-36
sp|B8EDS6|TDH_SHEB2 L-threonine 3-dehydrogenase OS=Shewanella baltica (strain OS223) GN=tdh PE=3 SV=1 46 377 2.0E-36
sp|B0TNM4|TDH_SHEHH L-threonine 3-dehydrogenase OS=Shewanella halifaxensis (strain HAW-EB4) GN=tdh PE=3 SV=1 42 377 2.0E-36
sp|A4YCC5|TDH_SHEPC L-threonine 3-dehydrogenase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=tdh PE=3 SV=1 46 377 3.0E-36
sp|A1S1Q3|TDH_SHEAM L-threonine 3-dehydrogenase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=tdh PE=3 SV=1 38 377 6.0E-36
sp|Q0HDA3|TDH_SHESM L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-4) GN=tdh PE=3 SV=1 46 377 7.0E-36
sp|A0L2Q3|TDH_SHESA L-threonine 3-dehydrogenase OS=Shewanella sp. (strain ANA-3) GN=tdh PE=3 SV=1 46 377 7.0E-36
sp|Q0HPI5|TDH_SHESR L-threonine 3-dehydrogenase OS=Shewanella sp. (strain MR-7) GN=tdh PE=3 SV=1 46 377 7.0E-36
sp|A4JKG7|TDH_BURVG L-threonine 3-dehydrogenase OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=tdh PE=3 SV=1 46 366 2.0E-35
sp|B1KL24|TDH_SHEWM L-threonine 3-dehydrogenase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=tdh PE=3 SV=1 42 377 2.0E-35
sp|A8GYP8|TDH_SHEPA L-threonine 3-dehydrogenase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=tdh PE=3 SV=1 42 377 3.0E-35
sp|A8FPE0|TDH_SHESH L-threonine 3-dehydrogenase OS=Shewanella sediminis (strain HAW-EB3) GN=tdh PE=3 SV=1 42 377 5.0E-35
sp|Q48AM4|TDH_COLP3 L-threonine 3-dehydrogenase OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=tdh PE=3 SV=1 46 377 6.0E-35
sp|B7LVH6|TDH_ESCF3 L-threonine 3-dehydrogenase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=tdh PE=3 SV=1 46 377 8.0E-35
sp|Q8E8J1|TDH_SHEON L-threonine 3-dehydrogenase OS=Shewanella oneidensis (strain MR-1) GN=tdh PE=3 SV=1 46 377 1.0E-34
sp|Q2K618|TDH_RHIEC L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CFN 42 / ATCC 51251) GN=tdh PE=3 SV=1 52 377 1.0E-34
sp|B3PUI4|TDH_RHIE6 L-threonine 3-dehydrogenase OS=Rhizobium etli (strain CIAT 652) GN=tdh PE=3 SV=1 52 377 1.0E-34
sp|A9AR24|TDH_BURM1 L-threonine 3-dehydrogenase OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=tdh PE=3 SV=1 46 366 1.0E-34
sp|Q07W50|TDH_SHEFN L-threonine 3-dehydrogenase OS=Shewanella frigidimarina (strain NCIMB 400) GN=tdh PE=3 SV=1 42 377 2.0E-34
sp|Q57517|Y053_HAEIN Uncharacterized zinc-type alcohol dehydrogenase-like protein HI_0053 OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0053 PE=3 SV=1 52 380 2.0E-34
sp|Q2T9E1|TDH_BURTA L-threonine 3-dehydrogenase OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=tdh PE=3 SV=1 46 366 3.0E-34
sp|A7MID0|TDH_CROS8 L-threonine 3-dehydrogenase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=tdh PE=3 SV=1 42 377 3.0E-34
sp|B2JPU0|TDH_BURP8 L-threonine 3-dehydrogenase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=tdh PE=3 SV=1 46 366 4.0E-34
sp|Q38ZS8|TDH_BURL3 L-threonine 3-dehydrogenase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=tdh PE=3 SV=1 48 366 4.0E-34
sp|Q63PD9|TDH_BURPS L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain K96243) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|A3NF91|TDH_BURP6 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 668) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|Q3JID4|TDH_BURP1 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1710b) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|A3P139|TDH_BURP0 L-threonine 3-dehydrogenase OS=Burkholderia pseudomallei (strain 1106a) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|A1UXP8|TDH_BURMS L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain SAVP1) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|Q62EL5|TDH_BURMA L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain ATCC 23344) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|A2RZW5|TDH_BURM9 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10229) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|A3MAC8|TDH_BURM7 L-threonine 3-dehydrogenase OS=Burkholderia mallei (strain NCTC 10247) GN=tdh PE=3 SV=1 46 383 5.0E-34
sp|B4EFZ7|TDH_BURCJ L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=tdh PE=3 SV=1 48 366 5.0E-34
sp|Q7MY48|TDH_PHOLL L-threonine 3-dehydrogenase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=tdh PE=3 SV=1 46 377 5.0E-34
sp|A0B459|TDH_BURCH L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain HI2424) GN=tdh PE=3 SV=1 48 366 6.0E-34
sp|B1K269|TDH_BURCC L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain MC0-3) GN=tdh PE=3 SV=1 48 366 6.0E-34
sp|Q1BK24|TDH_BURCA L-threonine 3-dehydrogenase OS=Burkholderia cenocepacia (strain AU 1054) GN=tdh PE=3 SV=1 48 366 6.0E-34
sp|Q1MDT5|TDH_RHIL3 L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. viciae (strain 3841) GN=tdh PE=3 SV=1 52 377 6.0E-34
sp|Q9Z9U1|DHSO_BACHD Sorbitol dehydrogenase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=gutB PE=3 SV=1 50 379 8.0E-34
sp|C3LWF0|TDH_VIBCM L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=tdh PE=3 SV=1 42 377 1.0E-33
sp|Q9KL62|TDH_VIBCH L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=tdh PE=3 SV=1 42 377 1.0E-33
sp|A5F0N6|TDH_VIBC3 L-threonine 3-dehydrogenase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=tdh PE=3 SV=1 42 377 1.0E-33
sp|A1JHX8|TDH_YERE8 L-threonine 3-dehydrogenase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=tdh PE=3 SV=1 46 377 2.0E-33
sp|C6DIA7|TDH_PECCP L-threonine 3-dehydrogenase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=tdh PE=3 SV=1 42 377 2.0E-33
sp|Q3YVY1|TDH_SHISS L-threonine 3-dehydrogenase OS=Shigella sonnei (strain Ss046) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q8ZL52|TDH_SALTY L-threonine 3-dehydrogenase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q8Z2F4|TDH_SALTI L-threonine 3-dehydrogenase OS=Salmonella typhi GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B4TZV9|TDH_SALSV L-threonine 3-dehydrogenase OS=Salmonella schwarzengrund (strain CVM19633) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B5BHZ1|TDH_SALPK L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain AKU_12601) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|C0Q1V0|TDH_SALPC L-threonine 3-dehydrogenase OS=Salmonella paratyphi C (strain RKS4594) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|A9MVL0|TDH_SALPB L-threonine 3-dehydrogenase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q5PC07|TDH_SALPA L-threonine 3-dehydrogenase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B4SXB9|TDH_SALNS L-threonine 3-dehydrogenase OS=Salmonella newport (strain SL254) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B4T9A1|TDH_SALHS L-threonine 3-dehydrogenase OS=Salmonella heidelberg (strain SL476) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B5R5E1|TDH_SALEP L-threonine 3-dehydrogenase OS=Salmonella enteritidis PT4 (strain P125109) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B5FLI6|TDH_SALDC L-threonine 3-dehydrogenase OS=Salmonella dublin (strain CT_02021853) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q57IC5|TDH_SALCH L-threonine 3-dehydrogenase OS=Salmonella choleraesuis (strain SC-B67) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B5EXC3|TDH_SALA4 L-threonine 3-dehydrogenase OS=Salmonella agona (strain SL483) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B5YWB7|TDH_ECO5E L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q8XEJ1|TDH_ECO57 L-threonine 3-dehydrogenase OS=Escherichia coli O157:H7 GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B1JQW2|TDH_YERPY L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|Q66GC5|TDH_YERPS L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B2JYP4|TDH_YERPB L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|A7FCU5|TDH_YERP3 L-threonine 3-dehydrogenase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=tdh PE=3 SV=1 46 377 3.0E-33
sp|B7NES3|TDH_ECOLU L-threonine 3-dehydrogenase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|A8GLC6|TDH_SERP5 L-threonine 3-dehydrogenase OS=Serratia proteamaculans (strain 568) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|Q1R4X4|TDH_ECOUT L-threonine 3-dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B1LK55|TDH_ECOSM L-threonine 3-dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|Q8FCA2|TDH_ECOL6 L-threonine 3-dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|A1AHF3|TDH_ECOK1 L-threonine 3-dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B7N1S0|TDH_ECO81 L-threonine 3-dehydrogenase OS=Escherichia coli O81 (strain ED1a) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B7NPC5|TDH_ECO7I L-threonine 3-dehydrogenase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B7MFI0|TDH_ECO45 L-threonine 3-dehydrogenase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B7ULH2|TDH_ECO27 L-threonine 3-dehydrogenase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|B5XTI4|TDH_KLEP3 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae (strain 342) GN=tdh PE=3 SV=1 46 377 4.0E-33
sp|P59409|TDH_SHIFL L-threonine 3-dehydrogenase OS=Shigella flexneri GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|Q0SYE5|TDH_SHIF8 L-threonine 3-dehydrogenase OS=Shigella flexneri serotype 5b (strain 8401) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|Q31V06|TDH_SHIBS L-threonine 3-dehydrogenase OS=Shigella boydii serotype 4 (strain Sb227) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B2U5D5|TDH_SHIB3 L-threonine 3-dehydrogenase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B6I3J6|TDH_ECOSE L-threonine 3-dehydrogenase OS=Escherichia coli (strain SE11) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B1IZH4|TDH_ECOLC L-threonine 3-dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|Q0TBJ0|TDH_ECOL5 L-threonine 3-dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|A8A681|TDH_ECOHS L-threonine 3-dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B7M4A3|TDH_ECO8A L-threonine 3-dehydrogenase OS=Escherichia coli O8 (strain IAI1) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B7L742|TDH_ECO55 L-threonine 3-dehydrogenase OS=Escherichia coli (strain 55989 / EAEC) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|A6TFL2|TDH_KLEP7 L-threonine 3-dehydrogenase OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=tdh PE=3 SV=1 46 377 5.0E-33
sp|B5RGH0|TDH_SALG2 L-threonine 3-dehydrogenase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=tdh PE=3 SV=1 46 377 6.0E-33
sp|Q0B5Q1|TDH_BURCM L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=tdh PE=3 SV=1 48 366 6.0E-33
sp|A4SHB7|TDH_AERS4 L-threonine 3-dehydrogenase OS=Aeromonas salmonicida (strain A449) GN=tdh PE=3 SV=1 46 377 6.0E-33
sp|B4S298|TDH_ALTMD L-threonine 3-dehydrogenase OS=Alteromonas macleodii (strain DSM 17117 / Deep ecotype) GN=tdh PE=3 SV=1 46 377 7.0E-33
sp|Q52998|TDH_RHIME L-threonine 3-dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=tdh PE=3 SV=2 42 377 7.0E-33
sp|B1YXP0|TDH_BURA4 L-threonine 3-dehydrogenase OS=Burkholderia ambifaria (strain MC40-6) GN=tdh PE=3 SV=1 48 366 7.0E-33
sp|Q83F39|TDH_COXBU L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=tdh PE=3 SV=1 42 377 7.0E-33
sp|A9NA21|TDH_COXBR L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=tdh PE=3 SV=1 42 377 7.0E-33
sp|A9KET6|TDH_COXBN L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=tdh PE=3 SV=1 42 377 7.0E-33
sp|B6J2S1|TDH_COXB2 L-threonine 3-dehydrogenase OS=Coxiella burnetii (strain CbuG_Q212) GN=tdh PE=3 SV=1 42 377 7.0E-33
sp|P59410|TDH_VIBPA L-threonine 3-dehydrogenase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=tdh PE=3 SV=1 42 377 8.0E-33
sp|C5BB99|TDH_EDWI9 L-threonine 3-dehydrogenase OS=Edwardsiella ictaluri (strain 93-146) GN=tdh PE=3 SV=1 46 377 8.0E-33
sp|O35045|YJMD_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YjmD OS=Bacillus subtilis (strain 168) GN=yjmD PE=2 SV=1 60 367 9.0E-33
sp|P07913|TDH_ECOLI L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12) GN=tdh PE=1 SV=1 46 377 1.0E-32
sp|B1X950|TDH_ECODH L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / DH10B) GN=tdh PE=3 SV=1 46 377 1.0E-32
sp|C4ZXK8|TDH_ECOBW L-threonine 3-dehydrogenase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=tdh PE=3 SV=1 46 377 1.0E-32
sp|B0TYR8|TDH_FRAP2 L-threonine 3-dehydrogenase OS=Francisella philomiragia subsp. philomiragia (strain ATCC 25017) GN=tdh PE=3 SV=1 52 368 1.0E-32
sp|A4TSC6|TDH_YERPP L-threonine 3-dehydrogenase OS=Yersinia pestis (strain Pestoides F) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|Q1CD13|TDH_YERPN L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|A9R685|TDH_YERPG L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|Q8ZJN2|TDH_YERPE L-threonine 3-dehydrogenase OS=Yersinia pestis GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|Q1C278|TDH_YERPA L-threonine 3-dehydrogenase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|A9MKQ8|TDH_SALAR L-threonine 3-dehydrogenase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|A7ZTH0|TDH_ECO24 L-threonine 3-dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|A0KQV6|TDH_AERHH L-threonine 3-dehydrogenase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=tdh PE=3 SV=1 46 377 2.0E-32
sp|Q329N8|TDH_SHIDS L-threonine 3-dehydrogenase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=tdh PE=3 SV=1 46 377 3.0E-32
sp|Q13SG2|TDH_BURXL L-threonine 3-dehydrogenase OS=Burkholderia xenovorans (strain LB400) GN=tdh PE=3 SV=1 48 366 4.0E-32
sp|B2T7X5|TDH_BURPP L-threonine 3-dehydrogenase OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=tdh PE=3 SV=1 48 366 4.0E-32
sp|Q8D442|TDH_VIBVU L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain CMCP6) GN=tdh PE=3 SV=1 42 377 5.0E-32
sp|B4F134|TDH_PROMH L-threonine 3-dehydrogenase OS=Proteus mirabilis (strain HI4320) GN=tdh PE=3 SV=1 46 377 5.0E-32
sp|B9J738|TDH_AGRRK L-threonine 3-dehydrogenase OS=Agrobacterium radiobacter (strain K84 / ATCC BAA-868) GN=tdh PE=3 SV=1 52 377 5.0E-32
sp|Q5QUN8|TDH_IDILO L-threonine 3-dehydrogenase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=tdh PE=3 SV=1 46 377 6.0E-32
sp|Q11L77|TDH_CHESB L-threonine 3-dehydrogenase OS=Chelativorans sp. (strain BNC1) GN=tdh PE=3 SV=1 41 366 6.0E-32
sp|B5ETJ6|TDH_VIBFM L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain MJ11) GN=tdh PE=3 SV=1 42 377 7.0E-32
sp|A4FND4|TDH_SACEN L-threonine 3-dehydrogenase OS=Saccharopolyspora erythraea (strain ATCC 11635 / DSM 40517 / JCM 4748 / NBRC 13426 / NCIMB 8594 / NRRL 2338) GN=tdh PE=3 SV=1 41 369 7.0E-32
sp|A6W1W3|TDH_MARMS L-threonine 3-dehydrogenase OS=Marinomonas sp. (strain MWYL1) GN=tdh PE=3 SV=1 46 377 7.0E-32
sp|Q7MFL5|TDH_VIBVY L-threonine 3-dehydrogenase OS=Vibrio vulnificus (strain YJ016) GN=tdh PE=3 SV=1 42 377 7.0E-32
sp|Q15ZU4|TDH_PSEA6 L-threonine 3-dehydrogenase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=tdh PE=3 SV=1 46 377 8.0E-32
sp|Q5E0F9|TDH_VIBF1 L-threonine 3-dehydrogenase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=tdh PE=3 SV=1 42 377 8.0E-32
sp|A4W529|TDH_ENT38 L-threonine 3-dehydrogenase OS=Enterobacter sp. (strain 638) GN=tdh PE=3 SV=1 46 377 9.0E-32
sp|A8ARK6|TDH_CITK8 L-threonine 3-dehydrogenase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=tdh PE=3 SV=1 46 377 9.0E-32
sp|B5ZXE7|TDH_RHILW L-threonine 3-dehydrogenase OS=Rhizobium leguminosarum bv. trifolii (strain WSM2304) GN=tdh PE=3 SV=1 52 377 1.0E-31
sp|Q6LRD9|TDH_PHOPR L-threonine 3-dehydrogenase OS=Photobacterium profundum GN=tdh PE=3 SV=2 42 377 1.0E-31
sp|Q6DAT5|TDH_PECAS L-threonine 3-dehydrogenase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=tdh PE=3 SV=1 42 377 1.0E-31
sp|C3MFH1|TDH_RHISN L-threonine 3-dehydrogenase OS=Rhizobium sp. (strain NGR234) GN=tdh PE=3 SV=1 42 377 2.0E-31
sp|A6UBM6|TDH_SINMW L-threonine 3-dehydrogenase OS=Sinorhizobium medicae (strain WSM419) GN=tdh PE=3 SV=1 42 377 3.0E-31
sp|P77539|YDJL_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YdjL OS=Escherichia coli (strain K12) GN=ydjL PE=3 SV=1 48 379 4.0E-31
sp|B6ESA4|TDH_ALISL L-threonine 3-dehydrogenase OS=Aliivibrio salmonicida (strain LFI1238) GN=tdh PE=3 SV=1 42 377 5.0E-31
sp|Q5WYJ7|TDH_LEGPL L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Lens) GN=tdh PE=3 SV=1 52 377 6.0E-31
sp|B7VR52|TDH_VIBTL L-threonine 3-dehydrogenase OS=Vibrio tasmaniensis (strain LGP32) GN=tdh PE=3 SV=1 42 377 6.0E-31
sp|B2SDJ2|TDH_FRATM L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. mediasiatica (strain FSC147) GN=tdh PE=3 SV=1 52 368 9.0E-31
sp|Q0BKV5|TDH_FRATO L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain OSU18) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|Q2A282|TDH_FRATH L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain LVS) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|A7NDM9|TDH_FRATF L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. holarctica (strain FTNF002-00 / FTA) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|A4IZ92|TDH_FRATW L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|Q5NGW4|TDH_FRATT L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|Q14IB6|TDH_FRAT1 L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|A0Q5K3|TDH_FRATN L-threonine 3-dehydrogenase OS=Francisella tularensis subsp. novicida (strain U112) GN=tdh PE=3 SV=1 52 368 1.0E-30
sp|A5IGK7|TDH_LEGPC L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Corby) GN=tdh PE=3 SV=1 46 377 1.0E-30
sp|Q5ZXM9|TDH_LEGPH L-threonine 3-dehydrogenase OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=tdh PE=3 SV=2 52 377 2.0E-30
sp|Q5LN53|TDH_RUEPO L-threonine 3-dehydrogenase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=tdh PE=3 SV=2 41 366 2.0E-30
sp|C1D195|TDH_DEIDV L-threonine 3-dehydrogenase OS=Deinococcus deserti (strain VCD115 / DSM 17065 / LMG 22923) GN=tdh PE=3 SV=1 46 377 2.0E-30
sp|Q5X748|TDH_LEGPA L-threonine 3-dehydrogenase OS=Legionella pneumophila (strain Paris) GN=tdh PE=3 SV=1 52 377 3.0E-30
sp|P39346|IDND_ECOLI L-idonate 5-dehydrogenase (NAD(P)(+)) OS=Escherichia coli (strain K12) GN=idnD PE=1 SV=1 62 381 4.0E-30
sp|Q8KQL2|ARPD_ENTAV D-arabitol-phosphate dehydrogenase OS=Enterococcus avium PE=1 SV=1 22 382 5.0E-29
sp|Q983J7|TDH_RHILO L-threonine 3-dehydrogenase OS=Rhizobium loti (strain MAFF303099) GN=tdh PE=3 SV=1 46 377 6.0E-29
sp|Q0KDL6|ADH_CUPNH Alcohol dehydrogenase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=adh PE=1 SV=1 37 382 7.0E-29
sp|Q9RTU4|TDH_DEIRA L-threonine 3-dehydrogenase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=tdh PE=3 SV=2 41 377 9.0E-29
sp|A7HEI5|TDH_ANADF L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain Fw109-5) GN=tdh PE=3 SV=1 52 377 2.0E-28
sp|Q7NXH5|TDH_CHRVO L-threonine 3-dehydrogenase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=tdh PE=3 SV=1 46 382 5.0E-28
sp|Q82MN2|TDH_STRAW L-threonine 3-dehydrogenase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=tdh PE=3 SV=1 46 377 5.0E-28
sp|B8J714|TDH_ANAD2 L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-1 / ATCC BAA-258) GN=tdh PE=3 SV=1 52 377 5.0E-28
sp|B4UMJ1|TDH_ANASK L-threonine 3-dehydrogenase OS=Anaeromyxobacter sp. (strain K) GN=tdh PE=3 SV=1 52 377 7.0E-28
sp|P14940|ADH_CUPNE Alcohol dehydrogenase OS=Cupriavidus necator GN=adh PE=3 SV=1 37 382 9.0E-28
sp|A1SVW5|TDH_PSYIN L-threonine 3-dehydrogenase OS=Psychromonas ingrahamii (strain 37) GN=tdh PE=3 SV=1 42 377 1.0E-27
sp|Q2MF72|DOIAD_STRLV 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces lividus GN=livE PE=3 SV=1 39 378 2.0E-27
sp|Q2MFP3|DOIAD_STRRY 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces rimosus subsp. paromomycinus GN=parE PE=3 SV=1 39 378 2.0E-27
sp|Q2IJN4|TDH_ANADE L-threonine 3-dehydrogenase OS=Anaeromyxobacter dehalogenans (strain 2CP-C) GN=tdh PE=3 SV=1 52 377 3.0E-27
sp|P39714|BDH1_YEAST (R,R)-butanediol dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH1 PE=1 SV=2 37 379 7.0E-27
sp|Q6AAR3|TDH_PROAC L-threonine 3-dehydrogenase OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=tdh PE=3 SV=1 42 377 1.0E-26
sp|O34268|TDH_XANCP L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=tdh PE=3 SV=1 46 377 1.0E-26
sp|B0RU31|TDH_XANCB L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain B100) GN=tdh PE=3 SV=1 46 377 1.0E-26
sp|Q4URI9|TDH_XANC8 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=tdh PE=3 SV=1 46 377 1.0E-26
sp|Q2MF22|DOIAD_STRSD 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptoalloteichus tenebrarius (strain ATCC 17920 / DSM 40477 / NCIB 11028) GN=tobE PE=3 SV=1 54 378 2.0E-26
sp|Q8PNN2|TDH_XANAC L-threonine 3-dehydrogenase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=tdh PE=3 SV=1 46 377 2.0E-26
sp|Q3BWT0|TDH_XANC5 L-threonine 3-dehydrogenase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=tdh PE=3 SV=1 46 377 3.0E-26
sp|B1VWE7|TDH_STRGG L-threonine 3-dehydrogenase OS=Streptomyces griseus subsp. griseus (strain JCM 4626 / NBRC 13350) GN=tdh PE=3 SV=1 46 377 4.0E-26
sp|Q67N85|TDH_SYMTH L-threonine 3-dehydrogenase OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=tdh PE=3 SV=1 48 377 8.0E-26
sp|P39713|BDH2_YEAST Probable diacetyl reductase [(R)-acetoin forming] 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=BDH2 PE=1 SV=1 39 364 9.0E-26
sp|Q5GWI3|TDH_XANOR L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=tdh PE=3 SV=2 46 377 1.0E-25
sp|Q2NZP2|TDH_XANOM L-threonine 3-dehydrogenase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=tdh PE=3 SV=1 46 377 1.0E-25
sp|Q9L233|TDH_STRCO L-threonine 3-dehydrogenase OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=tdh PE=3 SV=1 41 358 3.0E-25
sp|B2FQN4|TDH_STRMK L-threonine 3-dehydrogenase OS=Stenotrophomonas maltophilia (strain K279a) GN=tdh PE=3 SV=1 43 377 4.0E-25
sp|O34788|BDHA_BACSU (R,R)-butanediol dehydrogenase OS=Bacillus subtilis (strain 168) GN=bdhA PE=3 SV=1 37 382 4.0E-25
sp|Q6MD15|TDH_PARUW L-threonine 3-dehydrogenase OS=Protochlamydia amoebophila (strain UWE25) GN=tdh PE=3 SV=1 60 377 1.0E-24
sp|Q65JE7|TDH_BACLD L-threonine 3-dehydrogenase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=tdh PE=3 SV=1 52 368 2.0E-24
sp|Q6L743|DOIAD_STRKN 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces kanamyceticus GN=kanE PE=3 SV=1 39 383 2.0E-24
sp|Q8R7K0|TDH_CALS4 L-threonine 3-dehydrogenase OS=Caldanaerobacter subterraneus subsp. tengcongensis (strain DSM 15242 / JCM 11007 / NBRC 100824 / MB4) GN=tdh PE=3 SV=2 48 361 3.0E-24
sp|P77360|YPHC_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YphC OS=Escherichia coli (strain K12) GN=yphC PE=3 SV=2 36 383 1.0E-23
sp|Q02BT1|TDH_SOLUE L-threonine 3-dehydrogenase OS=Solibacter usitatus (strain Ellin6076) GN=tdh PE=3 SV=1 46 377 1.0E-23
sp|Q70KF0|DOIAD_MICEC 2-deoxy-scyllo-inosamine dehydrogenase OS=Micromonospora echinospora GN=gacH PE=3 SV=1 40 379 7.0E-23
sp|Q4R0J7|ARD1_UROFA D-arabinitol dehydrogenase 1 OS=Uromyces fabae GN=ARD1 PE=1 SV=1 29 382 2.0E-22
sp|P39400|LGOD_ECOLI L-galactonate-5-dehydrogenase OS=Escherichia coli (strain K12) GN=lgoD PE=1 SV=3 50 357 8.0E-22
sp|P38105|RSPB_ECOLI Starvation-sensing protein RspB OS=Escherichia coli (strain K12) GN=rspB PE=2 SV=1 44 366 1.0E-21
sp|Q4R0W1|DOIAD_STRRI 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces ribosidificus GN=rbmC PE=3 SV=1 48 369 2.0E-21
sp|Q53U21|DOIAD_STRFR 2-deoxy-scyllo-inosamine dehydrogenase OS=Streptomyces fradiae GN=neoA PE=1 SV=1 39 369 5.0E-21
sp|A4YGN0|SUCD_METS5 Succinate-semialdehyde dehydrogenase (acetylating) OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1424 PE=1 SV=1 55 368 4.0E-20
sp|Q96XE0|ADH_SULTO NAD-dependent alcohol dehydrogenase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=adh PE=1 SV=1 46 366 5.0E-19
sp|P0A9S3|GATD_ECOLI Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli (strain K12) GN=gatD PE=1 SV=1 60 360 6.0E-19
sp|P0A9S4|GATD_ECO57 Galactitol-1-phosphate 5-dehydrogenase OS=Escherichia coli O157:H7 GN=gatD PE=3 SV=1 60 360 6.0E-19
sp|Q07288|ADH1_KLUMA Alcohol dehydrogenase 1 OS=Kluyveromyces marxianus GN=ADH1 PE=3 SV=1 39 311 5.0E-18
sp|A7Z4X0|TDH_BACMF L-threonine 3-dehydrogenase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=tdh PE=3 SV=1 48 366 8.0E-18
sp|Q29318|DHSO_PIG Sorbitol dehydrogenase (Fragment) OS=Sus scrofa GN=SORD PE=2 SV=2 35 124 2.0E-17
sp|P12311|ADH1_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adhT PE=1 SV=2 53 352 5.0E-17
sp|P80094|FADH_AMYME S-(hydroxymethyl)mycothiol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 46 367 6.0E-17
sp|O31776|TDH_BACSU L-threonine 3-dehydrogenase OS=Bacillus subtilis (strain 168) GN=tdh PE=3 SV=1 48 368 8.0E-17
sp|P77316|YBDR_ECOLI Uncharacterized zinc-type alcohol dehydrogenase-like protein YbdR OS=Escherichia coli (strain K12) GN=ybdR PE=3 SV=1 47 368 9.0E-17
sp|O31186|ADHA_RHIME Alcohol dehydrogenase OS=Rhizobium meliloti (strain 1021) GN=adhA PE=3 SV=1 52 325 2.0E-16
sp|B2NI93|GEDH_CARLC Geraniol dehydrogenase OS=Carpoglyphus lactis GN=gedh PE=1 SV=2 56 371 4.0E-16
sp|P49384|ADH3_KLULA Alcohol dehydrogenase 3, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH3 PE=3 SV=2 39 225 5.0E-16
sp|P49383|ADH2_KLULA Alcohol dehydrogenase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH2 PE=3 SV=2 39 225 1.0E-15
sp|P14941|ADH_THEBR NADP-dependent isopropanol dehydrogenase OS=Thermoanaerobacter brockii GN=adh PE=1 SV=1 45 378 6.0E-15
sp|A4YGN2|ACAR_METS5 Acryloyl-coenzyme A reductase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=Msed_1426 PE=1 SV=1 34 305 6.0E-15
sp|P20369|ADH1_KLULA Alcohol dehydrogenase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH1 PE=3 SV=1 39 366 8.0E-15
sp|Q0W5A6|GLCDH_METAR Glucose 1-dehydrogenase OS=Methanocella arvoryzae (strain DSM 22066 / NBRC 105507 / MRE50) GN=gdh PE=3 SV=1 37 227 9.0E-15
sp|O06012|ADHB_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein AdhB OS=Bacillus subtilis (strain 168) GN=adhB PE=3 SV=2 37 382 1.0E-14
sp|O07737|Y1895_MYCTU Probable zinc-binding alcohol dehydrogenase Rv1895 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=Rv1895 PE=1 SV=1 37 369 1.0E-14
sp|Q703W7|GLCDH_THETK Glucose 1-dehydrogenase OS=Thermoproteus tenax (strain ATCC 35583 / NBRC 100435 / JCM 9277 / Kra 1) GN=gdh PE=1 SV=1 46 239 2.0E-14
sp|P42328|ADH3_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus PE=1 SV=1 53 352 3.0E-14
sp|Q9P4C2|ADH2_KLUMA Alcohol dehydrogenase 2 OS=Kluyveromyces marxianus GN=ADH2 PE=3 SV=3 39 348 4.0E-14
sp|D1YUK8|GLCDH_METPS Glucose 1-dehydrogenase OS=Methanocella paludicola (strain DSM 17711 / JCM 13418 / NBRC 101707 / SANAE) GN=gdh PE=3 SV=1 46 227 4.0E-14
sp|P80468|ADH4_STRCA Alcohol dehydrogenase 4 OS=Struthio camelus GN=ADH4 PE=1 SV=1 56 368 6.0E-14
sp|P22797|ADH1_PELPE Alcohol dehydrogenase 1 OS=Pelophylax perezi PE=1 SV=1 37 368 7.0E-14
sp|F0QUB3|GLCD1_VULM7 Glucose 1-dehydrogenase 1 OS=Vulcanisaeta moutnovskia (strain 768-28) GN=gdh1 PE=3 SV=1 46 316 8.0E-14
sp|P93629|ADHX_MAIZE Alcohol dehydrogenase class-3 OS=Zea mays GN=FDH PE=2 SV=1 37 368 1.0E-13
sp|P42327|ADH2_GEOSE Alcohol dehydrogenase OS=Geobacillus stearothermophilus GN=adh PE=1 SV=1 34 367 2.0E-13
sp|P9WQB9|ADHD_MYCTU Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhD PE=1 SV=1 37 367 2.0E-13
sp|P9WQB8|ADHD_MYCTO Putative alcohol dehydrogenase D OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhD PE=3 SV=1 37 367 2.0E-13
sp|Q45604|YYCR_BACSU Uncharacterized zinc-type alcohol dehydrogenase-like protein YycR OS=Bacillus subtilis (strain 168) GN=yycR PE=3 SV=1 61 289 2.0E-13
sp|O13309|ADH2_PICST Alcohol dehydrogenase 2 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH2 PE=3 SV=1 52 245 3.0E-13
sp|P07246|ADH3_YEAST Alcohol dehydrogenase 3, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH3 PE=1 SV=2 39 245 3.0E-13
sp|P80175|ADHN_AMYME NDMA-dependent alcohol dehydrogenase OS=Amycolatopsis methanolica PE=1 SV=2 56 367 3.0E-13
sp|P25406|ADH1B_SAAHA Alcohol dehydrogenase 1B OS=Saara hardwickii PE=1 SV=2 37 245 3.0E-13
sp|P50381|ADH_SULSR NAD-dependent alcohol dehydrogenase OS=Sulfolobus sp. (strain RC3) GN=adh PE=3 SV=1 54 366 6.0E-13
sp|F0QYK7|GLCD2_VULM7 Glucose 1-dehydrogenase 2 OS=Vulcanisaeta moutnovskia (strain 768-28) GN=gdh2 PE=3 SV=2 46 306 8.0E-13
sp|P35630|ADH1_ENTHI NADP-dependent isopropanol dehydrogenase OS=Entamoeba histolytica GN=ADH1 PE=1 SV=1 46 382 1.0E-12
sp|P38113|ADH5_YEAST Alcohol dehydrogenase 5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH5 PE=1 SV=1 39 231 1.0E-12
sp|Q6XQ67|ADH5_SACPS Alcohol dehydrogenase 5 OS=Saccharomyces pastorianus GN=ADH5 PE=3 SV=1 39 231 1.0E-12
sp|P00331|ADH2_YEAST Alcohol dehydrogenase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH2 PE=1 SV=3 39 244 2.0E-12
sp|P73138|FRMA_SYNY3 S-(hydroxymethyl)glutathione dehydrogenase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=frmA PE=3 SV=1 37 371 2.0E-12
sp|O94038|ADH2_CANAL Alcohol dehydrogenase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ADH2 PE=3 SV=1 52 347 6.0E-12
sp|Q0DWH1|ADHX_ORYSJ Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. japonica GN=Os02g0815500 PE=2 SV=1 56 366 7.0E-12
sp|A2XAZ3|ADHX_ORYSI Alcohol dehydrogenase class-3 OS=Oryza sativa subsp. indica GN=ADHIII PE=3 SV=1 56 366 8.0E-12
sp|P25984|ADH_CLOBE NADP-dependent isopropanol dehydrogenase OS=Clostridium beijerinckii GN=adh PE=1 SV=2 44 230 1.0E-11
sp|P40394|ADH7_HUMAN Alcohol dehydrogenase class 4 mu/sigma chain OS=Homo sapiens GN=ADH7 PE=1 SV=2 56 368 1.0E-11
sp|P00330|ADH1_YEAST Alcohol dehydrogenase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ADH1 PE=1 SV=5 39 244 2.0E-11
sp|P13603|ADH1_TRIRP Alcohol dehydrogenase 1 OS=Trifolium repens GN=ADH1 PE=2 SV=1 56 366 3.0E-11
sp|A1L4Y2|ADHL3_ARATH Alcohol dehydrogenase-like 3 OS=Arabidopsis thaliana GN=At1g32780 PE=2 SV=1 56 371 4.0E-11
sp|Q7A742|ADH_STAAN Alcohol dehydrogenase OS=Staphylococcus aureus (strain N315) GN=adh PE=1 SV=1 37 325 4.0E-11
sp|Q99W07|ADH_STAAM Alcohol dehydrogenase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q8NXU1|ADH_STAAW Alcohol dehydrogenase OS=Staphylococcus aureus (strain MW2) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q6GBM4|ADH_STAAS Alcohol dehydrogenase OS=Staphylococcus aureus (strain MSSA476) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q6GJ63|ADH_STAAR Alcohol dehydrogenase OS=Staphylococcus aureus (strain MRSA252) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q5HI63|ADH_STAAC Alcohol dehydrogenase OS=Staphylococcus aureus (strain COL) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q2YSX0|ADH_STAAB Alcohol dehydrogenase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q2G0G1|ADH_STAA8 Alcohol dehydrogenase OS=Staphylococcus aureus (strain NCTC 8325) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|Q2FJ31|ADH_STAA3 Alcohol dehydrogenase OS=Staphylococcus aureus (strain USA300) GN=adh PE=3 SV=1 37 325 4.0E-11
sp|P39462|ADH_SULSO NAD-dependent alcohol dehydrogenase OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=adh PE=1 SV=1 54 366 4.0E-11
sp|P12886|ADH1_PEA Alcohol dehydrogenase 1 OS=Pisum sativum PE=3 SV=1 56 366 5.0E-11
sp|P75214|ADH_MYCPN Probable NADP-dependent isopropanol dehydrogenase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=adh PE=3 SV=1 49 378 5.0E-11
sp|P25141|ADH1_PETHY Alcohol dehydrogenase 1 OS=Petunia hybrida GN=ADH1 PE=3 SV=1 56 366 1.0E-10
sp|A8M8R2|GLCD1_CALMQ Glucose 1-dehydrogenase 1 OS=Caldivirga maquilingensis (strain ATCC 700844 / DSM 13496 / JCM 10307 / IC-167) GN=gdh1 PE=3 SV=2 53 225 1.0E-10
sp|P08843|ADH1_EMENI Alcohol dehydrogenase 1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcA PE=3 SV=2 50 207 1.0E-10
sp|P41747|ADH1_ASPFN Alcohol dehydrogenase 1 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=adh1 PE=2 SV=2 50 207 2.0E-10
sp|Q9SK87|ADHL2_ARATH Alcohol dehydrogenase-like 2 OS=Arabidopsis thaliana GN=At1g22440 PE=2 SV=1 56 371 2.0E-10
sp|Q5HRD6|ADH_STAEQ Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=adh PE=3 SV=1 37 325 2.0E-10
sp|Q9P6C8|ADH1_NEUCR Alcohol dehydrogenase 1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=adh-1 PE=3 SV=1 50 231 2.0E-10
sp|P06757|ADH1_RAT Alcohol dehydrogenase 1 OS=Rattus norvegicus GN=Adh1 PE=1 SV=3 56 368 2.0E-10
sp|Q96533|ADHX_ARATH Alcohol dehydrogenase class-3 OS=Arabidopsis thaliana GN=ADH2 PE=1 SV=2 37 373 3.0E-10
sp|P80338|ADH1_STRCA Alcohol dehydrogenase 1 OS=Struthio camelus GN=ADH1 PE=1 SV=1 37 366 3.0E-10
sp|Q975C8|ACAR_SULTO Acryloyl-coenzyme A reductase OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=STK_04800 PE=1 SV=1 42 374 4.0E-10
sp|P41680|ADH1_PERMA Alcohol dehydrogenase 1 OS=Peromyscus maniculatus GN=ADH1 PE=2 SV=2 56 368 5.0E-10
sp|P86883|ADH1_COLLI Alcohol dehydrogenase 1 OS=Columba livia GN=ADH1 PE=1 SV=1 56 366 6.0E-10
sp|P49385|ADH4_KLULA Alcohol dehydrogenase 4, mitochondrial OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ADH4 PE=3 SV=2 39 225 6.0E-10
sp|Q64437|ADH7_MOUSE Alcohol dehydrogenase class 4 mu/sigma chain OS=Mus musculus GN=Adh7 PE=2 SV=2 56 368 9.0E-10
sp|P09347|FDEH_PSEPU 5-exo-hydroxycamphor dehydrogenase OS=Pseudomonas putida GN=camD PE=1 SV=2 37 368 9.0E-10
sp|P32771|FADH_YEAST S-(hydroxymethyl)glutathione dehydrogenase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SFA1 PE=1 SV=1 37 367 1.0E-09
sp|P49645|ADH1_APTAU Alcohol dehydrogenase 1 OS=Apteryx australis GN=ADH1 PE=1 SV=2 37 357 1.0E-09
sp|Q9QYY9|ADH4_MOUSE Alcohol dehydrogenase 4 OS=Mus musculus GN=Adh4 PE=1 SV=4 56 364 1.0E-09
sp|Q8CQ56|ADH_STAES Alcohol dehydrogenase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=adh PE=3 SV=1 37 325 1.0E-09
sp|P00327|ADH1E_HORSE Alcohol dehydrogenase E chain OS=Equus caballus PE=1 SV=2 56 368 1.0E-09
sp|P25405|ADH1A_SAAHA Alcohol dehydrogenase 1A OS=Saara hardwickii PE=1 SV=2 56 245 2.0E-09
sp|Q64563|ADH4_RAT Alcohol dehydrogenase 4 OS=Rattus norvegicus GN=Adh4 PE=2 SV=3 56 367 2.0E-09
sp|P07754|ADH3_EMENI Alcohol dehydrogenase 3 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcC PE=3 SV=1 50 207 2.0E-09
sp|P9WQC7|ADHB_MYCTU Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhB PE=1 SV=1 33 367 2.0E-09
sp|P9WQC6|ADHB_MYCTO Alcohol dehydrogenase B OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhB PE=3 SV=1 33 367 2.0E-09
sp|Q7U1B9|ADHB_MYCBO Alcohol dehydrogenase B OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhB PE=3 SV=1 33 367 2.0E-09
sp|Q3Z550|FRMA_SHISS S-(hydroxymethyl)glutathione dehydrogenase OS=Shigella sonnei (strain Ss046) GN=frmA PE=3 SV=1 37 366 3.0E-09
sp|B1J085|FRMA_ECOLC S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=frmA PE=3 SV=1 37 366 3.0E-09
sp|A7ZX04|FRMA_ECOHS S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O9:H4 (strain HS) GN=frmA PE=3 SV=1 37 366 3.0E-09
sp|Q8X5J4|FRMA_ECO57 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O157:H7 GN=frmA PE=3 SV=1 37 366 3.0E-09
sp|A7ZIA4|FRMA_ECO24 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=frmA PE=3 SV=1 37 366 3.0E-09
sp|P48977|ADH_MALDO Alcohol dehydrogenase OS=Malus domestica GN=ADH PE=2 SV=1 56 366 3.0E-09
sp|P00329|ADH1_MOUSE Alcohol dehydrogenase 1 OS=Mus musculus GN=Adh1 PE=1 SV=2 56 245 3.0E-09
sp|Q5XI95|ADH6_RAT Alcohol dehydrogenase 6 OS=Rattus norvegicus GN=Adh6 PE=2 SV=1 39 368 3.0E-09
sp|Q0J6T3|CADH5_ORYSJ Putative cinnamyl alcohol dehydrogenase 5 OS=Oryza sativa subsp. japonica GN=CAD5 PE=3 SV=2 53 189 3.0E-09
sp|Q8VZ49|ADHL4_ARATH Alcohol dehydrogenase-like 4 OS=Arabidopsis thaliana GN=At1g64710 PE=2 SV=1 60 368 4.0E-09
sp|P26325|ADH1_GADMC Alcohol dehydrogenase 1 OS=Gadus morhua subsp. callarias PE=1 SV=1 56 368 4.0E-09
sp|A4YGA7|GLCDH_METS5 Glucose 1-dehydrogenase OS=Metallosphaera sedula (strain ATCC 51363 / DSM 5348) GN=gdh PE=3 SV=1 59 230 4.0E-09
sp|P39450|FRMA_PHODP S-(hydroxymethyl)glutathione dehydrogenase OS=Photobacterium damsela subsp. piscicida GN=frmA PE=3 SV=1 37 371 5.0E-09
sp|O00097|ADH1_PICST Alcohol dehydrogenase 1 OS=Scheffersomyces stipitis (strain ATCC 58785 / CBS 6054 / NBRC 10063 / NRRL Y-11545) GN=ADH1 PE=3 SV=1 52 245 5.0E-09
sp|P0CH37|ADHC2_MYCS2 NADP-dependent alcohol dehydrogenase C 2 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhC2 PE=1 SV=1 53 306 5.0E-09
sp|P0CH36|ADHC1_MYCS2 NADP-dependent alcohol dehydrogenase C 1 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=adhc1 PE=1 SV=1 53 306 5.0E-09
sp|P25437|FRMA_ECOLI S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain K12) GN=frmA PE=1 SV=3 37 366 6.0E-09
sp|Q03505|ADH1_RABIT Alcohol dehydrogenase 1 OS=Oryctolagus cuniculus GN=ADH1 PE=1 SV=2 56 368 6.0E-09
sp|Q9SK86|ADHL1_ARATH Alcohol dehydrogenase-like 1 OS=Arabidopsis thaliana GN=At1g22430 PE=2 SV=1 56 308 7.0E-09
sp|Q43137|MTDH1_STYHU Probable mannitol dehydrogenase 1 OS=Stylosanthes humilis GN=CAD1 PE=2 SV=1 60 189 9.0E-09
sp|Q5RBP7|ADH1A_PONAB Alcohol dehydrogenase 1A OS=Pongo abelii GN=ADH1A PE=2 SV=3 56 368 1.0E-08
sp|P20368|ADH1_ZYMMO Alcohol dehydrogenase 1 OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=adhA PE=1 SV=2 37 356 1.0E-08
sp|Q1RFI7|FRMA_ECOUT S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain UTI89 / UPEC) GN=frmA PE=3 SV=1 37 366 1.0E-08
sp|Q0TKS7|FRMA_ECOL5 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=frmA PE=3 SV=1 37 366 1.0E-08
sp|A1A835|FRMA_ECOK1 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O1:K1 / APEC GN=frmA PE=3 SV=1 37 366 1.0E-08
sp|P08319|ADH4_HUMAN Alcohol dehydrogenase 4 OS=Homo sapiens GN=ADH4 PE=1 SV=5 56 368 1.0E-08
sp|P14219|ADH1_PENAM Alcohol dehydrogenase 1 OS=Pennisetum americanum GN=ADH1 PE=2 SV=1 56 370 1.0E-08
sp|P46154|FADH_PSEPU Glutathione-independent formaldehyde dehydrogenase OS=Pseudomonas putida GN=fdhA PE=1 SV=3 49 243 2.0E-08
sp|Q17334|ADH1_CAEEL Alcohol dehydrogenase 1 OS=Caenorhabditis elegans GN=sodh-1 PE=2 SV=2 50 139 2.0E-08
sp|B1LIP1|FRMA_ECOSM S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=frmA PE=3 SV=1 37 366 2.0E-08
sp|Q0V7W6|ADHL5_ARATH Alcohol dehydrogenase-like 5 OS=Arabidopsis thaliana GN=At4g22110 PE=2 SV=1 56 308 2.0E-08
sp|Q9HTE3|FADH_PSEAE Glutathione-independent formaldehyde dehydrogenase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=fdhA PE=3 SV=1 49 263 3.0E-08
sp|P43067|ADH1_CANAX Alcohol dehydrogenase 1 OS=Candida albicans GN=ADH1 PE=1 SV=1 52 348 3.0E-08
sp|Q8FKG1|FRMA_ECOL6 S-(hydroxymethyl)glutathione dehydrogenase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=frmA PE=3 SV=1 37 366 3.0E-08
sp|P07327|ADH1A_HUMAN Alcohol dehydrogenase 1A OS=Homo sapiens GN=ADH1A PE=1 SV=2 56 368 4.0E-08
sp|Q02972|CADH8_ARATH Cinnamyl alcohol dehydrogenase 8 OS=Arabidopsis thaliana GN=CAD8 PE=1 SV=1 53 318 5.0E-08
sp|P80512|ADH1_NAJNA Alcohol dehydrogenase 1 OS=Naja naja PE=1 SV=1 34 245 6.0E-08
sp|P47734|FADH_METMR S-(hydroxymethyl)glutathione dehydrogenase OS=Methylobacter marinus GN=fdh PE=3 SV=2 58 244 6.0E-08
sp|P86885|ADH1_MESAU Alcohol dehydrogenase 1 OS=Mesocricetus auratus GN=ADH1 PE=1 SV=1 56 368 6.0E-08
sp|P28469|ADH1A_MACMU Alcohol dehydrogenase 1A OS=Macaca mulatta GN=ADH1A PE=2 SV=2 56 368 6.0E-08
sp|P00328|ADH1S_HORSE Alcohol dehydrogenase S chain OS=Equus caballus PE=1 SV=3 56 368 7.0E-08
sp|Q977U7|GLCDH_HALMT Glucose 1-dehydrogenase OS=Haloferax mediterranei (strain ATCC 33500 / DSM 1411 / JCM 8866 / NBRC 14739 / NCIMB 2177 / R-4) GN=gdh PE=1 SV=1 48 218 7.0E-08
sp|Q82LU9|CCRA2_STRAW Crotonyl-CoA reductase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=ccrA2 PE=1 SV=1 41 379 7.0E-08
sp|Q9HS17|GLCDH_HALSA Glucose 1-dehydrogenase OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=gdh PE=3 SV=1 47 222 1.0E-07
sp|Q337Y2|CADH3_ORYSJ Probable cinnamyl alcohol dehydrogenase 3 OS=Oryza sativa subsp. japonica GN=CAD3 PE=2 SV=1 53 159 1.0E-07
sp|P06525|ADH1_ARATH Alcohol dehydrogenase class-P OS=Arabidopsis thaliana GN=ADH1 PE=1 SV=2 56 366 1.0E-07
sp|P00326|ADH1G_HUMAN Alcohol dehydrogenase 1C OS=Homo sapiens GN=ADH1C PE=1 SV=2 56 245 2.0E-07
sp|Q5R1W2|ADH1B_PANTR Alcohol dehydrogenase 1B OS=Pan troglodytes GN=ADH1B PE=2 SV=3 56 368 3.0E-07
sp|P9WQC1|ADHA_MYCTU Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhA PE=1 SV=1 54 238 4.0E-07
sp|P9WQC0|ADHA_MYCTO Probable alcohol dehydrogenase AdhA OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhA PE=3 SV=1 54 238 4.0E-07
sp|O97959|ADH1G_PAPHA Alcohol dehydrogenase 1C OS=Papio hamadryas GN=ADH1C PE=2 SV=3 56 245 5.0E-07
sp|Q52078|FDM_PSEPU Formaldehyde dismutase OS=Pseudomonas putida GN=fdm PE=1 SV=1 34 267 5.0E-07
sp|Q9Z2M2|ADH1_GEOAT Alcohol dehydrogenase 1 OS=Geomys attwateri GN=ADH1 PE=2 SV=3 56 368 1.0E-06
sp|Q42726|CADH1_EUCGU Probable cinnamyl alcohol dehydrogenase 1 OS=Eucalyptus gunnii GN=CAD1 PE=3 SV=1 57 202 1.0E-06
sp|F2Z678|ADH2_YARLI Alcohol dehydrogenase 2 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=ADH2 PE=1 SV=1 52 189 2.0E-06
sp|O82515|MTDH_MEDSA Probable mannitol dehydrogenase OS=Medicago sativa GN=CAD1 PE=1 SV=1 53 189 2.0E-06
sp|P44557|FRMA_HAEIN S-(hydroxymethyl)glutathione dehydrogenase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=frmA PE=3 SV=1 37 368 2.0E-06
sp|Q64415|ADH1_GEOKN Alcohol dehydrogenase 1 OS=Geomys knoxjonesi GN=ADH1 PE=2 SV=3 56 245 2.0E-06
sp|O45687|ADH2_CAEEL Alcohol dehydrogenase 2 OS=Caenorhabditis elegans GN=sodh-2 PE=3 SV=1 50 161 2.0E-06
sp|O94564|YGD6_SCHPO Zinc-type alcohol dehydrogenase-like protein C1773.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC1773.06c PE=3 SV=1 55 333 2.0E-06
sp|P86884|ADHX_SCYCA Alcohol dehydrogenase class-3 OS=Scyliorhinus canicula PE=1 SV=1 56 368 2.0E-06
sp|P9WQC5|ADHC_MYCTU NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=adhC PE=1 SV=1 53 306 3.0E-06
sp|P9WQC4|ADHC_MYCTO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=adhC PE=3 SV=1 53 306 3.0E-06
sp|P0A4X1|ADHC_MYCBO NADP-dependent alcohol dehydrogenase C OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=adhC PE=3 SV=1 53 306 3.0E-06
sp|P54202|ADH2_EMENI Alcohol dehydrogenase 2 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=alcB PE=3 SV=2 31 207 3.0E-06
sp|C0SPA5|ADHA_BACSU Probable formaldehyde dehydrogenase AdhA OS=Bacillus subtilis (strain 168) GN=adhA PE=2 SV=1 58 232 3.0E-06
sp|Q64413|ADH1_GEOBU Alcohol dehydrogenase 1 OS=Geomys bursarius GN=ADH1 PE=2 SV=3 56 245 3.0E-06
sp|P45382|FADH_PARDE S-(hydroxymethyl)glutathione dehydrogenase OS=Paracoccus denitrificans GN=flhA PE=1 SV=1 56 368 3.0E-06
sp|Q02971|CADH7_ARATH Cinnamyl alcohol dehydrogenase 7 OS=Arabidopsis thaliana GN=CAD7 PE=1 SV=2 53 201 3.0E-06
sp|P72324|ADHI_RHOS4 Alcohol dehydrogenase class-3 OS=Rhodobacter sphaeroides (strain ATCC 17023 / 2.4.1 / NCIB 8253 / DSM 158) GN=adhI PE=3 SV=1 56 368 5.0E-06
sp|Q9ZRF1|MTDH_FRAAN Probable mannitol dehydrogenase OS=Fragaria ananassa GN=CAD PE=2 SV=1 53 179 6.0E-06
sp|Q08350|CADH7_PICAB Probable cinnamyl alcohol dehydrogenase 7/8 OS=Picea abies GN=CAD7 PE=2 SV=1 57 306 7.0E-06
sp|O82035|CADH2_PICAB Probable cinnamyl alcohol dehydrogenase 2 OS=Picea abies GN=CAD2 PE=3 SV=1 57 306 8.0E-06
sp|O64969|CADH_EUCGL Probable cinnamyl alcohol dehydrogenase OS=Eucalyptus globulus GN=CAD PE=2 SV=1 57 200 9.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092440
MVMTGNAGVYDPRRVLEHADFKVLQKGEKPVPGANIAAFYNPAHEIHLVQKPRPKPGPGQVLLHVRATGICGSDV
HFWKHGRIGDSMVLSDECGSGHESAGEIVEVGEGVTQWQPGDRVAIEAGVPCSQPSCDACRLGRYNGCPDVVFFS
TPPYHGTLTRWHLHPAQWLHRLPDNVSFEEGSLCEPLSVALAGIERAGLRLGDPLLICGAGPIGLVTLLSARAAG
AEPIVITDLFQSRLDFAKKLIPGVRTVLIKKELTAKEQAEEVKKAAGCQLTVTLECTGVESSIHTAAYSLKFGGK
LFIIGVGKSEQILPFMHLSVNEIDVGFLYRYANQYPKAIRLISSGLVNVKPLVTHRFALEDAIDAFHVAADPTQG
AIKVQIRD*
Coding >AgabiH97|092440
ATGGTTATGACAGGCAATGCAGGAGTATATGATCCTCGCAGAGTCCTAGAACATGCAGATTTTAAGGTCTTACAG
AAAGGAGAGAAGCCTGTTCCAGGAGCAAACATTGCCGCGTTTTATAATCCTGCTCATGAAATACATCTTGTGCAA
AAGCCTAGGCCAAAACCAGGTCCTGGACAAGTATTACTGCACGTACGTGCTACTGGTATTTGCGGGAGTGATGTG
CATTTTTGGAAGCATGGGAGAATTGGTGATTCTATGGTCCTTTCTGACGAGTGTGGATCAGGACATGAAAGTGCC
GGTGAGATTGTTGAAGTAGGCGAAGGTGTCACACAGTGGCAGCCAGGAGACAGGGTTGCGATCGAAGCTGGTGTT
CCGTGCTCTCAACCTTCTTGTGATGCCTGCAGGTTAGGAAGGTATAACGGTTGTCCTGACGTCGTGTTCTTCTCT
ACGCCACCTTACCACGGTACTCTGACACGATGGCATCTGCATCCCGCTCAATGGCTACACCGCCTTCCCGACAAC
GTTTCATTTGAGGAAGGCTCCCTGTGTGAGCCTCTGTCAGTAGCCTTGGCAGGAATAGAACGTGCAGGCCTGCGC
CTCGGAGACCCACTTCTTATTTGTGGCGCAGGACCGATCGGTCTAGTCACCCTTCTCTCTGCTCGAGCAGCAGGA
GCGGAACCTATAGTCATAACCGACCTCTTCCAGTCTCGTCTGGATTTCGCCAAAAAACTCATTCCGGGTGTCCGC
ACCGTTTTGATTAAGAAAGAATTGACAGCGAAAGAACAAGCTGAAGAGGTCAAGAAAGCTGCGGGTTGCCAATTG
ACAGTCACATTGGAATGTACCGGTGTTGAGAGTAGCATTCACACAGCAGCATACTCACTAAAGTTCGGTGGGAAA
TTGTTTATTATTGGTGTTGGGAAGAGCGAACAGATTCTTCCATTCATGCACCTCAGTGTCAACGAAATCGACGTC
GGCTTCCTCTACCGTTATGCCAACCAATACCCCAAGGCCATTCGTCTGATCTCTTCAGGTCTCGTCAATGTCAAA
CCATTAGTTACTCACCGTTTCGCACTCGAAGATGCCATCGATGCTTTCCACGTAGCCGCTGATCCAACTCAAGGT
GCAATCAAGGTCCAGATTCGCGATTGA
Transcript >AgabiH97|092440
ATGGTTATGACAGGCAATGCAGGAGTATATGATCCTCGCAGAGTCCTAGAACATGCAGATTTTAAGGTCTTACAG
AAAGGAGAGAAGCCTGTTCCAGGAGCAAACATTGCCGCGTTTTATAATCCTGCTCATGAAATACATCTTGTGCAA
AAGCCTAGGCCAAAACCAGGTCCTGGACAAGTATTACTGCACGTACGTGCTACTGGTATTTGCGGGAGTGATGTG
CATTTTTGGAAGCATGGGAGAATTGGTGATTCTATGGTCCTTTCTGACGAGTGTGGATCAGGACATGAAAGTGCC
GGTGAGATTGTTGAAGTAGGCGAAGGTGTCACACAGTGGCAGCCAGGAGACAGGGTTGCGATCGAAGCTGGTGTT
CCGTGCTCTCAACCTTCTTGTGATGCCTGCAGGTTAGGAAGGTATAACGGTTGTCCTGACGTCGTGTTCTTCTCT
ACGCCACCTTACCACGGTACTCTGACACGATGGCATCTGCATCCCGCTCAATGGCTACACCGCCTTCCCGACAAC
GTTTCATTTGAGGAAGGCTCCCTGTGTGAGCCTCTGTCAGTAGCCTTGGCAGGAATAGAACGTGCAGGCCTGCGC
CTCGGAGACCCACTTCTTATTTGTGGCGCAGGACCGATCGGTCTAGTCACCCTTCTCTCTGCTCGAGCAGCAGGA
GCGGAACCTATAGTCATAACCGACCTCTTCCAGTCTCGTCTGGATTTCGCCAAAAAACTCATTCCGGGTGTCCGC
ACCGTTTTGATTAAGAAAGAATTGACAGCGAAAGAACAAGCTGAAGAGGTCAAGAAAGCTGCGGGTTGCCAATTG
ACAGTCACATTGGAATGTACCGGTGTTGAGAGTAGCATTCACACAGCAGCATACTCACTAAAGTTCGGTGGGAAA
TTGTTTATTATTGGTGTTGGGAAGAGCGAACAGATTCTTCCATTCATGCACCTCAGTGTCAACGAAATCGACGTC
GGCTTCCTCTACCGTTATGCCAACCAATACCCCAAGGCCATTCGTCTGATCTCTTCAGGTCTCGTCAATGTCAAA
CCATTAGTTACTCACCGTTTCGCACTCGAAGATGCCATCGATGCTTTCCACGTAGCCGCTGATCCAACTCAAGGT
GCAATCAAGGTCCAGATTCGCGATTGA
Gene >AgabiH97|092440
ATGGTTATGACAGGCAATGCAGGAGTATATGATCCTCGCAGAGTCCTAGAACATGCAGATTTTAAGGTCTTACAG
AAAGGAGAGAAGCCTGTTCCAGGAGCAAACATTGCCGCGTTTTATAATCCTGCTCATGAAATACATCTTGTGCAA
AAGCCTAGGCCAAAACCAGGTCCTGGACAAGTATTACTGCACGTACGTGCTACTGGTATTTGCGGGTAGGTCGTT
TCGATACAAAGTCGAAGATGTTTTCAGTTCATCTGTCATCTGAATGGACTCTGATCGGACCCTGTGTAGGAGTGA
TGTGCATTTTTGGAAGCATGGGAGAATTGGTGATTCTATGGTCCTTTCTGACGAGGTGAGAGGGTCTAGCGAATC
TCATTAATGAGTAATGTTTCTAAGATGGGCGTGGTTGCAATTAGTGTGGATCAGGACATGAAAGTGCCGGTGAGA
TTGTTGAAGTAGGCGAAGGTGTCACACAGTGGCAGCCAGGAGACAGGGTTGCGATCGAAGCTGGTGTTCCGTGCT
CTCAACCTTCTTGTGATGCCTGCAGGTTAGGAAGGTATAACGGTTGTCCTGACGTCGTGTTCTTCTCTACGCCAC
CTTACCACGGTACGTCCACGATCAGCTTTGTGTGATTATTTGTTAAGTGTGCTTCTAGGTACTCTGACACGATGG
CATCTGCATCCCGCTCAATGGCTACACCGCCTTCCCGACAACGTTTCATTTGAGGAAGGCTCCCTGTGTGAGCCT
CTGTCAGTAGCCTTGGCAGGAATAGAACGTGCAGGCCTGCGCCTCGGAGACCCACTTCTTATTTGGTGCGTTCAC
CCTATGTTCCCTCTTTAATTTCACATGAACCTTGACTTATTGTTGTAACAATCCGGCCATGTAATGCAGTGGCGC
AGGACCGATCGGTCTAGTCACCCTTCTCTCTGCTCGAGCAGCAGGAGCGGAACCTATAGTCATAACCGACCTCTT
CCAGTCTCGTCTGGATTTCGCCAAAAAACTCATTCCGGGTGTCCGCACCGTTTTGATTAAGAAAGAATTGACAGC
GAAAGAACAAGCTGAAGAGGTCAAGAAAGCTGCGGGTTGCCAATTGACAGTCACATTGGAATGTACCGGTGTTGA
GAGTAGCATTCACACAGCAGCATACGTACGCATCTGAATTCCCTCCCATTTCGCTTGTCGATCGCTGACAAGGGT
GTTATGATCGTCACCAGTCACTAAAGTTCGGTGGGAAATTGTTTATTATTGGTGTTGGGAAGAGCGAACAGATTG
TATGTTTCTAGCTGATAGCCGTCCACGAGACAAGCATGAGATTTCTTACATACACTTTCTAGCTTCCATTCATGC
ACCTCAGTGTCAACGAAATCGACGTCGGCTTCCTCTACCGTTATGCCAACCAATACCCCAAGGCCATTCGTCTGA
TCTCTTCAGGTCTCGTCAATGTCAAACCATTAGTTACTCACCGTTTCGCACTCGAAGATGCCATCGATGCTTTCC
ACGTAGCCGCTGATCCAACTCAAGGTGCAATCAAGGTCCAGATTCGCGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail