Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092430
Gene name
Locationscaffold_6:1103464..1108047
Strand+
Gene length (bp)4583
Transcript length (bp)3684
Coding sequence length (bp)3684
Protein length (aa) 1228

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07500 TFIIS_M Transcription factor S-II (TFIIS), central domain 1.2E-17 298 451
PF07744 SPOC SPOC domain 2.3E-12 801 959
PF00628 PHD PHD-finger 4.8E-08 91 138

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7V2|BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bye1 PE=3 SV=3 731 1042 2.0E-14
sp|Q6C0K9|BYE1_YARLI Transcription factor BYE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BYE1 PE=3 SV=1 368 535 3.0E-11
sp|Q92576|PHF3_HUMAN PHD finger protein 3 OS=Homo sapiens GN=PHF3 PE=1 SV=3 680 1027 8.0E-08
sp|Q32L53|LFG1_BOVIN Protein lifeguard 1 OS=Bos taurus GN=GRINA PE=2 SV=1 1070 1150 2.0E-06
sp|Q8C9B9|DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus GN=Dido1 PE=1 SV=4 783 935 3.0E-06
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7V2|BYE1_SCHPO Transcription factor bye1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=bye1 PE=3 SV=3 731 1042 2.0E-14
sp|Q6C0K9|BYE1_YARLI Transcription factor BYE1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=BYE1 PE=3 SV=1 368 535 3.0E-11
sp|Q92576|PHF3_HUMAN PHD finger protein 3 OS=Homo sapiens GN=PHF3 PE=1 SV=3 680 1027 8.0E-08
sp|Q32L53|LFG1_BOVIN Protein lifeguard 1 OS=Bos taurus GN=GRINA PE=2 SV=1 1070 1150 2.0E-06
sp|Q8C9B9|DIDO1_MOUSE Death-inducer obliterator 1 OS=Mus musculus GN=Dido1 PE=1 SV=4 783 935 3.0E-06
sp|Q9WTU0|PHF2_MOUSE Lysine-specific demethylase PHF2 OS=Mus musculus GN=Phf2 PE=1 SV=2 90 148 3.0E-06
sp|O74508|SPP1_SCHPO Set1 complex component spp1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=spp1 PE=3 SV=1 85 159 3.0E-06
sp|Q6P949|PHF2_DANRE Lysine-specific demethylase phf2 OS=Danio rerio GN=phf2 PE=2 SV=3 90 144 4.0E-06
sp|O75151|PHF2_HUMAN Lysine-specific demethylase PHF2 OS=Homo sapiens GN=PHF2 PE=1 SV=4 90 148 4.0E-06
sp|Q12830|BPTF_HUMAN Nucleosome-remodeling factor subunit BPTF OS=Homo sapiens GN=BPTF PE=1 SV=3 91 147 5.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006351 transcription, DNA-templated Yes
GO:0043170 macromolecule metabolic process No
GO:0016070 RNA metabolic process No
GO:0009058 biosynthetic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:1901576 organic substance biosynthetic process No
GO:0019438 aromatic compound biosynthetic process No
GO:0008152 metabolic process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0018130 heterocycle biosynthetic process No
GO:0034654 nucleobase-containing compound biosynthetic process No
GO:0009059 macromolecule biosynthetic process No
GO:1901362 organic cyclic compound biosynthetic process No
GO:0097659 nucleic acid-templated transcription No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0032774 RNA biosynthetic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092430
MTTRARTRAAAAAAAAAATSSPAPPQPLSQPTPKAKANSTRKSAATPVSVKQEHPHPADPSDKENIKNTTTPSRA
PTTKKQKSSRPIKTAYCTCTKGDDGSPMIRCAECKIWYHFICVDLTEHEAEEINVYICPLCTQSTGRKTAMTWEG
AEALDDCGSDVETAAPKATAQKAKKQKLSVSTKVAPSVPPLHPPPSSEESDNESEDDYVAEQDTTKAAKSKGKRR
LRHRSSSNSDSNNSSDDEATRKRKTKSRRISRSLTPVSPVVPSAKSRLKRKSSIAESPQSPIKRKKTETATDDPV
RKYCLGKLEEVFRQVFFRYPHVRQDASMEVESDHEQSTDEVIFKKLEDMTDEEKEALTNASKRFTAELEQCIFDI
YSEPDKNNAPHPGGKYKDRFRMLQFNLSKSDRTVIHKRIISGQISPKEISMMSSTDLADEETKQHIKIAEKESLA
QTILEKPVVPRAKITHKGLQDIEDVTGEHARIREAERQREREQEEEERREREKRERLKAVEKQRQRTQSLSLPPE
SPVVSSHSPVGITDNGASSSSWGAPPPIPSHVLQQGTSTVGDDILPSQSISRPLFPNIVTDAEMGTAAPEPELNL
ADLINIDEDGGEQESSSGNGISGPANAEDELGSGVAPTPVTDQSTEPNGGTSEKSHAPALQTISGLGQITASPSS
PMTPVVGISPFSSSRPRGLSFDLNSLWSGPNHDDMSHTPESPTAAGKEAEAKSVDNGDSKMGTTGGGETKASSVL
GPERIEVANDDDFDMFLEEKDETLEARPGPAGSTEPEPSVSQDPEAIFETIQQCWTGKIHMPLDSAAPQSTTVRA
RQIGGRVLGYQSTWWKTLFPSEELRIDGRVATQSSSEFLTQVRLNPAKELIAVAFSPVAEGSKADFYALTGYLKS
RDRHGLIFPWGQRPKDWAPGRELYLIPLLSSEPLPLYIELLDELKIPKTRKSDYMIGIWVLGRGKLNGPPPVLPS
ATPASAPSALTPTAPPVPPPMIPNIPTLPPHLSASTPSLPQSLPNLLGAITTPPLGLPPQVNQAALAKEVASLSQ
DQIQNLLKSLSTTSLPFSTPTPGAPSQVQPFHSGPSPPPPHPQWPGFPMAGPPPPPHGGYPPPGFGGPRPSLPPP
PPSHGPPMDDRRDSYPPPPHGPHHGGRGAGDRDRDRGSGWRGGREGRQHRGRGKHRGGGGGGGGGGGGGGGGPNL
PPRPVDSGWPRRQKGDDGSGRSPGRRW*
Coding >AgabiH97|092430
ATGACCACCCGCGCCCGTACAAGAGCTGCAGCGGCGGCGGCAGCGGCAGCAGCAACCTCTTCTCCCGCACCTCCA
CAACCGCTGTCCCAGCCCACCCCCAAGGCAAAAGCAAACTCCACCCGGAAATCTGCCGCAACACCCGTTTCTGTC
AAGCAAGAGCACCCGCACCCTGCAGATCCGTCGGATAAAGAAAACATCAAAAATACCACAACACCTTCCAGAGCT
CCCACCACCAAGAAACAAAAATCATCAAGACCAATCAAAACCGCGTATTGTACGTGCACGAAAGGAGACGATGGC
TCACCTATGATTAGATGTGCCGAATGTAAAATATGGTACCACTTTATCTGTGTTGATCTGACCGAACACGAGGCG
GAGGAGATAAATGTATATATATGCCCCCTCTGTACCCAGTCTACAGGTCGAAAAACAGCTATGACATGGGAAGGC
GCTGAAGCACTCGATGACTGCGGCAGTGATGTGGAAACAGCTGCACCCAAAGCAACGGCGCAGAAGGCGAAGAAG
CAGAAGCTATCCGTCTCCACGAAGGTGGCTCCCTCCGTCCCCCCGCTCCACCCCCCGCCCTCCTCAGAAGAATCA
GATAATGAGAGTGAAGATGATTATGTAGCCGAGCAGGATACAACCAAAGCTGCCAAGTCTAAAGGAAAGCGCCGT
CTTCGCCATCGTTCTTCCTCCAACTCAGATTCTAATAACTCATCCGATGATGAAGCCACACGCAAGCGCAAAACG
AAAAGTCGTCGAATTTCAAGGTCCCTAACCCCTGTTTCACCAGTGGTACCATCCGCCAAGTCTCGTCTCAAACGA
AAGTCAAGTATAGCAGAATCACCCCAGAGCCCGATCAAGCGCAAGAAGACTGAAACCGCCACAGATGACCCCGTT
CGGAAATATTGTCTTGGGAAGCTGGAAGAAGTCTTTCGCCAAGTGTTCTTCAGGTATCCTCATGTTCGTCAGGAC
GCCTCCATGGAGGTTGAAAGTGATCATGAGCAATCTACAGATGAGGTTATCTTCAAGAAATTGGAAGATATGACT
GACGAGGAGAAAGAGGCTTTGACGAATGCTAGTAAACGTTTTACCGCTGAACTTGAGCAGTGTATATTCGACATT
TATTCGGAACCTGATAAGAATAATGCACCGCATCCTGGTGGCAAATACAAGGATCGCTTCCGTATGCTGCAGTTC
AATCTGAGCAAATCCGACCGGACTGTTATCCATAAACGCATCATAAGTGGCCAAATTTCACCAAAGGAGATTTCT
ATGATGTCTTCGACCGACCTCGCAGATGAAGAAACCAAACAACACATTAAGATCGCGGAGAAAGAATCTCTCGCG
CAGACAATTCTAGAAAAGCCCGTTGTTCCGCGCGCCAAGATCACACATAAGGGTTTGCAGGATATTGAAGATGTC
ACCGGAGAACACGCACGGATCAGAGAAGCCGAGCGACAAAGGGAGCGAGAACAGGAGGAAGAGGAGAGGAGAGAG
CGTGAAAAGAGGGAAAGATTGAAGGCTGTTGAGAAACAGAGACAACGAACGCAATCTCTTAGTCTTCCGCCAGAA
TCTCCAGTCGTATCGAGTCACAGCCCTGTCGGTATCACGGATAATGGCGCTTCGAGTTCGTCATGGGGTGCTCCT
CCTCCTATCCCTTCGCATGTCCTACAACAAGGGACATCTACGGTTGGCGACGATATTCTTCCCAGCCAGTCAATT
AGCAGACCGCTGTTCCCGAACATTGTCACTGACGCGGAAATGGGGACCGCTGCTCCGGAACCGGAATTGAATCTG
GCTGACTTGATTAATATAGATGAAGATGGAGGAGAACAAGAAAGCAGTAGCGGGAATGGGATCAGTGGGCCTGCG
AATGCAGAGGACGAGTTAGGGTCTGGTGTTGCGCCCACTCCGGTCACGGATCAGTCCACTGAACCAAATGGCGGC
ACTTCCGAAAAGAGCCATGCCCCTGCCCTGCAGACGATCTCCGGACTGGGACAAATCACGGCTTCACCCAGCAGT
CCAATGACTCCTGTCGTTGGCATTTCTCCATTTTCATCATCACGACCACGAGGATTGTCGTTTGACCTAAATTCG
CTCTGGTCCGGTCCGAATCACGATGATATGTCTCATACACCCGAGTCTCCGACTGCAGCTGGAAAAGAAGCCGAA
GCGAAGAGTGTTGATAATGGCGATTCCAAAATGGGGACTACTGGTGGAGGCGAGACCAAGGCTTCGAGCGTTTTG
GGTCCTGAACGCATCGAAGTCGCCAACGACGATGATTTTGATATGTTTCTGGAAGAGAAAGACGAAACTTTGGAA
GCGCGGCCTGGTCCGGCAGGATCGACCGAACCCGAACCTTCTGTGAGCCAAGACCCTGAAGCTATATTTGAGACT
ATTCAACAGTGTTGGACGGGCAAGATTCATATGCCACTTGACTCAGCGGCGCCTCAGTCAACGACTGTGCGTGCC
AGGCAGATTGGTGGGCGGGTTCTCGGTTACCAATCTACTTGGTGGAAGACATTATTCCCTTCAGAAGAACTGAGA
ATTGATGGCCGCGTGGCGACTCAGAGCTCTTCGGAATTCTTGACTCAAGTTCGCCTGAATCCCGCCAAAGAACTG
ATTGCAGTTGCTTTTTCGCCAGTCGCTGAAGGTTCTAAAGCTGATTTTTACGCACTCACCGGTTATCTCAAATCG
AGAGATCGTCATGGACTTATATTTCCCTGGGGTCAAAGACCAAAGGATTGGGCACCAGGACGTGAATTGTATCTC
ATACCTTTGCTCTCAAGTGAACCTTTACCACTATACATCGAACTTTTGGATGAACTCAAGATTCCGAAAACCAGG
AAAAGCGATTATATGATCGGAATATGGGTCTTAGGAAGAGGGAAACTTAATGGTCCTCCTCCTGTACTACCTTCA
GCTACTCCCGCATCTGCCCCATCTGCATTGACGCCGACAGCCCCTCCTGTTCCGCCTCCTATGATCCCTAATATT
CCGACGCTACCTCCTCACCTCTCAGCTTCCACTCCATCTCTTCCTCAGTCTCTACCCAATCTTTTGGGCGCGATT
ACTACTCCGCCTCTAGGTTTGCCACCACAAGTCAATCAAGCTGCACTTGCAAAGGAAGTGGCGTCTCTCTCACAG
GATCAAATTCAGAATCTATTGAAATCATTATCTACTACAAGCCTTCCTTTCAGTACACCGACTCCTGGCGCACCT
TCTCAGGTGCAACCTTTTCACAGTGGACCATCACCACCACCACCTCATCCTCAATGGCCCGGTTTTCCCATGGCG
GGTCCTCCGCCTCCCCCTCATGGAGGGTATCCTCCTCCAGGATTTGGTGGTCCCAGACCATCACTTCCTCCGCCC
CCTCCATCACATGGACCACCGATGGATGATCGCCGAGATTCTTATCCTCCGCCGCCTCATGGTCCTCATCATGGC
GGAAGAGGTGCTGGAGATCGTGATCGAGATCGTGGTAGTGGCTGGCGCGGTGGTCGTGAAGGTAGACAACACCGC
GGTCGCGGGAAACACCGTGGTGGCGGCGGCGGAGGTGGCGGAGGTGGAGGTGGAGGCGGGGGAGGACCAAATCTG
CCACCCCGACCTGTTGATTCTGGTTGGCCGAGAAGGCAAAAGGGTGATGACGGGAGTGGAAGAAGTCCTGGCCGT
CGCTGGTAA
Transcript >AgabiH97|092430
ATGACCACCCGCGCCCGTACAAGAGCTGCAGCGGCGGCGGCAGCGGCAGCAGCAACCTCTTCTCCCGCACCTCCA
CAACCGCTGTCCCAGCCCACCCCCAAGGCAAAAGCAAACTCCACCCGGAAATCTGCCGCAACACCCGTTTCTGTC
AAGCAAGAGCACCCGCACCCTGCAGATCCGTCGGATAAAGAAAACATCAAAAATACCACAACACCTTCCAGAGCT
CCCACCACCAAGAAACAAAAATCATCAAGACCAATCAAAACCGCGTATTGTACGTGCACGAAAGGAGACGATGGC
TCACCTATGATTAGATGTGCCGAATGTAAAATATGGTACCACTTTATCTGTGTTGATCTGACCGAACACGAGGCG
GAGGAGATAAATGTATATATATGCCCCCTCTGTACCCAGTCTACAGGTCGAAAAACAGCTATGACATGGGAAGGC
GCTGAAGCACTCGATGACTGCGGCAGTGATGTGGAAACAGCTGCACCCAAAGCAACGGCGCAGAAGGCGAAGAAG
CAGAAGCTATCCGTCTCCACGAAGGTGGCTCCCTCCGTCCCCCCGCTCCACCCCCCGCCCTCCTCAGAAGAATCA
GATAATGAGAGTGAAGATGATTATGTAGCCGAGCAGGATACAACCAAAGCTGCCAAGTCTAAAGGAAAGCGCCGT
CTTCGCCATCGTTCTTCCTCCAACTCAGATTCTAATAACTCATCCGATGATGAAGCCACACGCAAGCGCAAAACG
AAAAGTCGTCGAATTTCAAGGTCCCTAACCCCTGTTTCACCAGTGGTACCATCCGCCAAGTCTCGTCTCAAACGA
AAGTCAAGTATAGCAGAATCACCCCAGAGCCCGATCAAGCGCAAGAAGACTGAAACCGCCACAGATGACCCCGTT
CGGAAATATTGTCTTGGGAAGCTGGAAGAAGTCTTTCGCCAAGTGTTCTTCAGGTATCCTCATGTTCGTCAGGAC
GCCTCCATGGAGGTTGAAAGTGATCATGAGCAATCTACAGATGAGGTTATCTTCAAGAAATTGGAAGATATGACT
GACGAGGAGAAAGAGGCTTTGACGAATGCTAGTAAACGTTTTACCGCTGAACTTGAGCAGTGTATATTCGACATT
TATTCGGAACCTGATAAGAATAATGCACCGCATCCTGGTGGCAAATACAAGGATCGCTTCCGTATGCTGCAGTTC
AATCTGAGCAAATCCGACCGGACTGTTATCCATAAACGCATCATAAGTGGCCAAATTTCACCAAAGGAGATTTCT
ATGATGTCTTCGACCGACCTCGCAGATGAAGAAACCAAACAACACATTAAGATCGCGGAGAAAGAATCTCTCGCG
CAGACAATTCTAGAAAAGCCCGTTGTTCCGCGCGCCAAGATCACACATAAGGGTTTGCAGGATATTGAAGATGTC
ACCGGAGAACACGCACGGATCAGAGAAGCCGAGCGACAAAGGGAGCGAGAACAGGAGGAAGAGGAGAGGAGAGAG
CGTGAAAAGAGGGAAAGATTGAAGGCTGTTGAGAAACAGAGACAACGAACGCAATCTCTTAGTCTTCCGCCAGAA
TCTCCAGTCGTATCGAGTCACAGCCCTGTCGGTATCACGGATAATGGCGCTTCGAGTTCGTCATGGGGTGCTCCT
CCTCCTATCCCTTCGCATGTCCTACAACAAGGGACATCTACGGTTGGCGACGATATTCTTCCCAGCCAGTCAATT
AGCAGACCGCTGTTCCCGAACATTGTCACTGACGCGGAAATGGGGACCGCTGCTCCGGAACCGGAATTGAATCTG
GCTGACTTGATTAATATAGATGAAGATGGAGGAGAACAAGAAAGCAGTAGCGGGAATGGGATCAGTGGGCCTGCG
AATGCAGAGGACGAGTTAGGGTCTGGTGTTGCGCCCACTCCGGTCACGGATCAGTCCACTGAACCAAATGGCGGC
ACTTCCGAAAAGAGCCATGCCCCTGCCCTGCAGACGATCTCCGGACTGGGACAAATCACGGCTTCACCCAGCAGT
CCAATGACTCCTGTCGTTGGCATTTCTCCATTTTCATCATCACGACCACGAGGATTGTCGTTTGACCTAAATTCG
CTCTGGTCCGGTCCGAATCACGATGATATGTCTCATACACCCGAGTCTCCGACTGCAGCTGGAAAAGAAGCCGAA
GCGAAGAGTGTTGATAATGGCGATTCCAAAATGGGGACTACTGGTGGAGGCGAGACCAAGGCTTCGAGCGTTTTG
GGTCCTGAACGCATCGAAGTCGCCAACGACGATGATTTTGATATGTTTCTGGAAGAGAAAGACGAAACTTTGGAA
GCGCGGCCTGGTCCGGCAGGATCGACCGAACCCGAACCTTCTGTGAGCCAAGACCCTGAAGCTATATTTGAGACT
ATTCAACAGTGTTGGACGGGCAAGATTCATATGCCACTTGACTCAGCGGCGCCTCAGTCAACGACTGTGCGTGCC
AGGCAGATTGGTGGGCGGGTTCTCGGTTACCAATCTACTTGGTGGAAGACATTATTCCCTTCAGAAGAACTGAGA
ATTGATGGCCGCGTGGCGACTCAGAGCTCTTCGGAATTCTTGACTCAAGTTCGCCTGAATCCCGCCAAAGAACTG
ATTGCAGTTGCTTTTTCGCCAGTCGCTGAAGGTTCTAAAGCTGATTTTTACGCACTCACCGGTTATCTCAAATCG
AGAGATCGTCATGGACTTATATTTCCCTGGGGTCAAAGACCAAAGGATTGGGCACCAGGACGTGAATTGTATCTC
ATACCTTTGCTCTCAAGTGAACCTTTACCACTATACATCGAACTTTTGGATGAACTCAAGATTCCGAAAACCAGG
AAAAGCGATTATATGATCGGAATATGGGTCTTAGGAAGAGGGAAACTTAATGGTCCTCCTCCTGTACTACCTTCA
GCTACTCCCGCATCTGCCCCATCTGCATTGACGCCGACAGCCCCTCCTGTTCCGCCTCCTATGATCCCTAATATT
CCGACGCTACCTCCTCACCTCTCAGCTTCCACTCCATCTCTTCCTCAGTCTCTACCCAATCTTTTGGGCGCGATT
ACTACTCCGCCTCTAGGTTTGCCACCACAAGTCAATCAAGCTGCACTTGCAAAGGAAGTGGCGTCTCTCTCACAG
GATCAAATTCAGAATCTATTGAAATCATTATCTACTACAAGCCTTCCTTTCAGTACACCGACTCCTGGCGCACCT
TCTCAGGTGCAACCTTTTCACAGTGGACCATCACCACCACCACCTCATCCTCAATGGCCCGGTTTTCCCATGGCG
GGTCCTCCGCCTCCCCCTCATGGAGGGTATCCTCCTCCAGGATTTGGTGGTCCCAGACCATCACTTCCTCCGCCC
CCTCCATCACATGGACCACCGATGGATGATCGCCGAGATTCTTATCCTCCGCCGCCTCATGGTCCTCATCATGGC
GGAAGAGGTGCTGGAGATCGTGATCGAGATCGTGGTAGTGGCTGGCGCGGTGGTCGTGAAGGTAGACAACACCGC
GGTCGCGGGAAACACCGTGGTGGCGGCGGCGGAGGTGGCGGAGGTGGAGGTGGAGGCGGGGGAGGACCAAATCTG
CCACCCCGACCTGTTGATTCTGGTTGGCCGAGAAGGCAAAAGGGTGATGACGGGAGTGGAAGAAGTCCTGGCCGT
CGCTGGTAA
Gene >AgabiH97|092430
ATGACCACCCGCGCCCGTACAAGAGCTGCAGCGGCGGCGGCAGCGGCAGCAGCAACCTCTTCTCCCGCACCTCCA
CAACCGCTGTCCCAGCCCACCCCCAAGGCAAAAGCAAACTCCACCCGGAAATCTGCCGCAACACCCGTTTCTGTC
AAGCAAGAGCACCCGCACCCTGCAGATCCGTCGGATAAAGAAAACATCAAAAATACCACAACACCTTCCAGAGCT
CCCACCACCAAGAAACAAAAATCATCAAGACCAATCAAAACCGCGTATTGTACGTGCACGAAAGGAGACGATGGC
TCACCTATGATTAGATGTGCCGAATGTAAAATATGGTGCGTGCAAACCTCCGTGTGCGTTTTCACAACCCACCGC
TCACACAGAGACATAGGTACCACTTTATCTGTGTTGATCTGACCGAACACGAGGCGGAGGAGATAAGTGAGTAAT
GTCTCACCATCCAGCTGGACCACCAGTCTAACACCTCTCTTTCTAGATGTATATATATGCCCCCTCTGTACCCAG
TCTACAGGTCGAAAAACAGCTAGTAAGTCCAACGCGCGACATACCCTTCCCCTCCGCCCTTCCGTATTCCGTATG
TCCAGTACCCAGAGAAAAGCAATTTCACAATCCGAAATCTGTTCTCGTATTGAACTCTTCAATTTGCTGTGTAAC
TTTCGCCATTTATTGCATCGCGCCCCCTCTCCTCCCAGTATATCGAGGGGCGACTGCCTTCCGTCATGCATATCA
ACCTGAGCTACGTATAGTGTGTATTTGTAACACATGTCCTTCGCCGTCTCCCTTGCCATCCTCGTGTATCGTGGG
TCCATGGTTGATTGGATGGGTTGCTTGAGGAGCATGTCTTGCGCCGATTTAGCGCCTGTGGTGGCTTGCTTTCCC
CTGAGACCAAGTTCCTCGGTCACTGAGTAGCATAGCTAATTTTAAGGCAATATCTCGTGCATTATTCGGTTGGAG
GTGGCGAAAGTTACACATTTGGCGCATTTTAAAAGTGAAATTGCTCATTTCTCAGTACTGCACGGATGCTTTTCT
CTTTCTTCGCTTTCATTGATCTCATCTGGGAAGAACTGCTGACTGACTATATATCAATTTTTAGTGACATGGGAA
GGCGCTGAAGCACTCGATGACTGCGGCAGTGATGTGGAAACAGCTGCACCCAAAGCAACGGCGCAGAAGGCGAAG
AAGCAGAAGCTATCCGTCTCCACGAAGGTGGCTCCCTCCGTCCCCCCGCTCCACCCCCCGCCCTCCTCAGAAGAA
TCAGATAATGAGAGTGAAGATGATTATGTAGCCGAGCAGGATACAACCAAAGCTGCCAAGTCTAAAGGAAAGGTA
ATATCCTTTACTCTATCATCAATGAATTCACATGCTCAAAATTTTCACAACGTAGCGCCGTCTTCGCCATCGTTC
TTCCTCCAACTCAGATTCTAATAACTCATCCGATGATGAAGCCACACGCAAGCGCAAAACGAAAAGTCGTCGAAT
TTCAAGGTCCCTAACCCCTGTTTCACCAGTGGTACCATCCGCCAAGTCTCGTCTCAAACGAAAGTCAAGTATAGC
AGAATCACCCCAGAGCCCGATCAAGCGCAAGAAGACTGAAACCGCCACAGATGACCCCGTTCGGAAATATTGTCT
TGGGAAGCTGGAAGAAGTCTTTCGCCAAGTGTTCTTCAGGTATCCTCATGTTCGTCAGGACGCCTCCATGGAGGT
TGAAAGTGATCATGAGCAATCTACAGATGAGGTTATCTTCAAGAAATTGGAAGATATGACTGACGAGGAGAAAGA
GGCTTTGACGAATGCTAGTAAACGTTTTACCGCTGAACTTGAGCAGTGTATATTCGACATTTATTCGGAACCTGA
TAAGAATAATGCACCGCATCCTGGTGGCAAATACAAGTAAGCTTTCAAGGCATCCTACCTGATTTATTTTTAACC
ACTGTCTCTAGGGATCGCTTCCGTATGCTGCAGTTCAATCTGAGCAAATCCGACCGGACTGTTATCCATAAACGC
ATCATAAGTGGCCAAATTTCACCAAAGGAGATTTCTATGATGTCTTCGACCGACCTCGCAGATGAAGAAACCAAA
CAACACATTAAGATCGCGGAGAAAGAATCTCTCGCGCAGACAATTCTAGAAAAGCCCGTTGTTCCGCGCGCCAAG
ATCACACATAAGGGTTTGCAGGATATTGAAGATGTCACCGGAGAACACGCACGGATCAGAGAAGCCGAGCGACAA
AGGGAGCGAGAACAGGAGGAAGAGGAGAGGAGAGAGCGTGAAAAGAGGGAAAGATTGAAGGCTGTTGAGAAACAG
AGACAACGAACGCAATCTCTTAGTCTTCCGCCAGAATCTCCAGTCGTATCGAGTCACAGCCCTGTCGGTATCACG
GATAATGGCGCTTCGAGTTCGTCATGGGGTGCTCCTCCTCCTATCCCTTCGCATGTCCTACAACAAGGGACATCT
ACGGTTGGCGACGATATTCTTCCCAGCCAGTCAATTAGCAGACCGCTGTTCCCGAACATTGTCACTGACGCGGAA
ATGGGGACCGCTGCTCCGGAACCGGAATTGAATCTGGCTGACTTGATTAATATAGATGAAGATGGAGGAGAACAA
GAAAGCAGTAGCGGGAATGGGATCAGTGGGCCTGCGAATGCAGAGGACGAGTTAGGGTCTGGTGTTGCGCCCACT
CCGGTCACGGATCAGTCCACTGAACCAAATGGCGGCACTTCCGAAAAGAGCCATGCCCCTGCCCTGCAGACGATC
TCCGGACTGGGACAAATCACGGCTTCACCCAGCAGTCCAATGACTCCTGTCGTTGGCATTTCTCCATTTTCATCA
TCACGACCACGAGGATTGTCGTTTGACCTAAATTCGCTCTGGTCCGGTCCGAATCACGATGATATGTCTCATACA
CCCGAGTCTCCGACTGCAGCTGGAAAAGAAGCCGAAGCGAAGAGTGTTGATAATGGCGATTCCAAAATGGGGACT
ACTGGTGGAGGCGAGACCAAGGCTTCGAGCGTTTTGGGTCCTGAACGCATCGAAGTCGCCAACGACGATGATTTT
GATATGTTTCTGGAAGAGAAAGACGAAACTTTGGAAGCGCGGCCTGGTCCGGCAGGATCGACCGAACCCGAACCT
TCTGTGAGCCAAGACCCTGAAGCTATATTTGAGACTATTCAACAGTGTTGGACGGGCAAGGTAAAGTTCATTGCA
CGTAGGGTCTTGCCGACTCATCTGACTGATCTGATATATATAGATTCATATGCCACTTGACTCAGCGGCGCCTCA
GTCAACGACTGTGCGTGCCAGGCAGATTGGTGGGCGGGTTCTCGGTTACCAATCTACTTGGTGGAAGACATTATT
CCCTTCAGAAGAACTGAGAATTGATGGCCGCGTGGCGACTCAGAGCTCTTCGGAATTCTTGACTCAAGTTCGCCT
GAATCCCGCCAAAGAACTGATTGCAGTTGCTTTTTCGCCAGTCGCTGAAGGTTCTAAAGCTGATTTTTACGCACT
CACCGGTTATCTCAAATCGAGAGAGTAAGTTTTTCCTTCTCGAATCTGGCTTTCAGATGTTAACTGCGTGTTTTT
ACAGTCGTCATGGACTTATATTTCCCTGGGGTCAAAGACCAAAGGATTGGGCACCAGGACGTGAATTGTATCTCA
TACCTTTGCTCTCAAGTGAACCTTTACCACTATACATCGAACTTTTGGATGAACTCAAGATTCCGAAAACCAGGA
AAAGCGATTATATGATCGGAATATGGGTCTTAGGAAGAGGGAAACTTAATGGTCCTCCTCCTGTACTACCTTCAG
CTACTCCCGCATCTGCCCCATCTGCATTGACGCCGACAGCCCCTCCTGTTCCGCCTCCTATGATCCCTAATATTC
CGACGCTACCTCCTCACCTCTCAGCTTCCACTCCATCTCTTCCTCAGTCTCTACCCAATCTTTTGGGCGCGATTA
CTACTCCGCCTCTAGGTTTGCCACCACAAGTCAATCAAGCTGCACTTGCAAAGGAAGTGGCGTCTCTCTCACAGG
ATCAAATTCAGAATCTATTGAAATCATTATCTACTACAAGCCTTCCTTTCAGTACACCGACTCCTGGCGCACCTT
CTCAGGTGCAACCTTTTCACAGTGGACCATCACCACCACCACCTCATCCTCAATGGCCCGGTTTTCCCATGGCGG
GTCCTCCGCCTCCCCCTCATGGAGGGTATCCTCCTCCAGGATTTGGTGGTCCCAGACCATCACTTCCTCCGCCCC
CTCCATCACATGGACCACCGATGGATGATCGCCGAGATTCTTATCCTCCGCCGCCTCATGGTCCTCATCATGGCG
GAAGAGGTGCTGGAGATCGTGATCGAGATCGTGGTAGTGGCTGGCGCGGTGGTCGTGAAGGTAGACAACACCGCG
GTCGCGGGAAACACCGTGGTGGCGGCGGCGGAGGTGGCGGAGGTGGAGGTGGAGGCGGGGGAGGACCAAATCTGC
CACCCCGACCTGTTGATTCTGGTTGGCCGAGAAGGCAAAAGGGTGATGACGGGAGTGGAAGAAGTCCTGGCCGTC
GCTGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail