Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092210
Gene name
Locationscaffold_6:1044036..1045275
Strand-
Gene length (bp)1239
Transcript length (bp)1047
Coding sequence length (bp)1047
Protein length (aa) 349

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 1.1E-07 98 186

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 58 347 8.0E-74
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 58 347 9.0E-64
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 58 347 4.0E-63
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 58 347 7.0E-63
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 58 347 7.0E-63
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 58 347 8.0E-74
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 58 347 9.0E-64
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 58 347 4.0E-63
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 58 347 7.0E-63
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 58 347 7.0E-63
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 58 348 9.0E-63
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 58 348 2.0E-62
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 58 348 1.0E-61
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 58 347 4.0E-59
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 58 348 1.0E-55
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 19 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 115.25 66.33 164.16
Initials Initials knots 11.39 5.46 17.32
Pileal_Stipeal_center Stage I stipe center 23.06 12.18 33.94
Pileal_Stipeal_shell Stage I stipe shell 8.22 3.75 12.68
DIF_stipe_center Stage II stipe center 52.30 30.01 74.60
DIF_stipe_shell Stage II stipe shell 37.02 20.73 53.31
DIF_stipe_skin Stage II stipe skin 17.11 8.57 25.64
DIF_cap_skin Stage II cap skin 16.70 8.40 24.99
DIF_cap_tissue Stage II cap tissue 26.92 14.47 39.37
DIF_gill_tissue Stage II gill tissue 20.15 10.32 29.98
YFB_stipe_center Young fruiting body stipe center 68.94 40.80 97.08
YFB_stipe_shell Young fruiting body stipe shell 59.14 34.61 83.66
YFB_stipe_skin Young fruiting body stipe skin 20.81 10.72 30.90
YFB_cap_skin Young fruiting body cap skin 9.36 4.31 14.42
YFB_cap_tissue Young fruiting body cap tissue 36.08 19.99 52.16
YFB_gill_tissue Young fruiting body gill tissue 7.99 3.23 12.76
YFB_veil Young fruiting body veil 10.40 4.90 15.89

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.066584 no
Casing YFB_stipe_shell 0.012577 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.002084 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.000613 yes
DIF_gill_tissue YFB_stipe_skin 0.960693 no
DIF_gill_tissue YFB_cap_skin 0.025711 yes
DIF_gill_tissue YFB_cap_tissue 0.058542 no
DIF_gill_tissue YFB_gill_tissue 0.011350 yes
DIF_gill_tissue YFB_veil 0.045487 yes
YFB_stipe_center YFB_stipe_shell 0.712265 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.000613 yes
YFB_stipe_center YFB_cap_tissue 0.019715 yes
YFB_stipe_center YFB_gill_tissue 0.000613 yes
YFB_stipe_center YFB_veil 0.000613 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.093997 no
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.021322 yes
YFB_stipe_skin YFB_cap_tissue 0.091499 no
YFB_stipe_skin YFB_gill_tissue 0.008457 yes
YFB_stipe_skin YFB_veil 0.036455 yes
YFB_cap_skin YFB_cap_tissue 0.000613 yes
YFB_cap_skin YFB_gill_tissue 0.808819 no
YFB_cap_skin YFB_veil 0.871023 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.000613 yes
YFB_gill_tissue YFB_veil 0.620893 no
Initials DIF_gill_tissue 0.106969 no
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.087755 no
Initials YFB_cap_skin 0.719249 no
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.458373 no
Initials YFB_veil 0.884832 no
Initials Pileal_Stipeal_center 0.029164 yes
Initials Pileal_Stipeal_shell 0.474959 no
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.312500 no
Initials DIF_cap_skin 0.346435 no
Initials DIF_cap_tissue 0.006387 yes
Pileal_Stipeal_center DIF_gill_tissue 0.798644 no
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.855567 no
Pileal_Stipeal_center YFB_cap_skin 0.006032 yes
Pileal_Stipeal_center YFB_cap_tissue 0.173722 no
Pileal_Stipeal_center YFB_gill_tissue 0.002525 yes
Pileal_Stipeal_center YFB_veil 0.014374 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.002951 yes
Pileal_Stipeal_center DIF_stipe_center 0.003765 yes
Pileal_Stipeal_center DIF_stipe_shell 0.142789 no
Pileal_Stipeal_center DIF_stipe_skin 0.482755 no
Pileal_Stipeal_center DIF_cap_skin 0.425463 no
Pileal_Stipeal_center DIF_cap_tissue 0.754323 no
Pileal_Stipeal_shell DIF_gill_tissue 0.009446 yes
Pileal_Stipeal_shell YFB_stipe_center 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.008457 yes
Pileal_Stipeal_shell YFB_cap_skin 0.840537 no
Pileal_Stipeal_shell YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.971947 no
Pileal_Stipeal_shell YFB_veil 0.649456 no
Pileal_Stipeal_shell DIF_stipe_center 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.037140 yes
Pileal_Stipeal_shell DIF_cap_skin 0.042909 yes
Pileal_Stipeal_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_center DIF_gill_tissue 0.000613 yes
DIF_stipe_center YFB_stipe_center 0.427938 no
DIF_stipe_center YFB_stipe_shell 0.787173 no
DIF_stipe_center YFB_stipe_skin 0.001140 yes
DIF_stipe_center YFB_cap_skin 0.000613 yes
DIF_stipe_center YFB_cap_tissue 0.265039 no
DIF_stipe_center YFB_gill_tissue 0.000613 yes
DIF_stipe_center YFB_veil 0.000613 yes
DIF_stipe_center DIF_stipe_shell 0.300880 no
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.000613 yes
DIF_stipe_center DIF_cap_tissue 0.022111 yes
DIF_stipe_shell DIF_gill_tissue 0.045701 yes
DIF_stipe_shell YFB_stipe_center 0.019442 yes
DIF_stipe_shell YFB_stipe_shell 0.117324 no
DIF_stipe_shell YFB_stipe_skin 0.071413 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.966584 no
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.013186 yes
DIF_stipe_shell DIF_cap_skin 0.008121 yes
DIF_stipe_shell DIF_cap_tissue 0.370264 no
DIF_stipe_skin DIF_gill_tissue 0.754370 no
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.695213 no
DIF_stipe_skin YFB_cap_skin 0.106349 no
DIF_stipe_skin YFB_cap_tissue 0.021846 yes
DIF_stipe_skin YFB_gill_tissue 0.051520 no
DIF_stipe_skin YFB_veil 0.178958 no
DIF_stipe_skin DIF_cap_skin 0.971478 no
DIF_stipe_skin DIF_cap_tissue 0.204814 no
DIF_cap_skin DIF_gill_tissue 0.708771 no
DIF_cap_skin YFB_stipe_center 0.000613 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.647314 no
DIF_cap_skin YFB_cap_skin 0.121262 no
DIF_cap_skin YFB_cap_tissue 0.013186 yes
DIF_cap_skin YFB_gill_tissue 0.056958 no
DIF_cap_skin YFB_veil 0.208106 no
DIF_cap_skin DIF_cap_tissue 0.171933 no
DIF_cap_tissue DIF_gill_tissue 0.465509 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.002951 yes
DIF_cap_tissue YFB_stipe_skin 0.544449 no
DIF_cap_tissue YFB_cap_skin 0.001140 yes
DIF_cap_tissue YFB_cap_tissue 0.438501 no
DIF_cap_tissue YFB_gill_tissue 0.000613 yes
DIF_cap_tissue YFB_veil 0.003765 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092210
MRFYYTLIATFLPVFALAGKSYDTHLRSRHASRAAGLRIRADDTYVPNATVSNGNPPYHRHEHYEGESFFKEWDF
FTGEDPTHGNVNYQSLSNAQRKQLAYVKDGVTVLAVDNSSSVPVGGKRDSVRITTKKTWNFGLFIADFAYMPWGC
GIWPAYWSVGPDWPNAGEIDILEGVNNQTWNQYTIHTGIECVLPDNSAGIDALASPMGKTCTSSNGANSGCGYQN
NNPNSYGAGFNAAGGGVLVHEWNSWGVKIWFFTRDSIPVDITNEQPNPTSWGTPTAAWPSRDCDFSSALYEHSLV
IDTTLCGDWAGSAYGDSGCPGTCQEVVANPANFANAQWGVNYISVYQS*
Coding >AgabiH97|092210
ATGCGCTTTTATTATACACTCATTGCGACTTTTCTTCCAGTCTTTGCACTTGCCGGCAAGTCTTACGACACCCAT
TTGCGTTCCCGACATGCCAGTCGCGCGGCGGGACTACGTATCCGAGCAGACGATACTTATGTACCCAACGCGACT
GTCAGTAATGGAAACCCTCCATATCATCGACATGAGCATTATGAAGGGGAATCATTTTTTAAGGAATGGGATTTT
TTCACCGGAGAAGATCCAACCCATGGAAATGTGAATTATCAATCACTCAGTAACGCTCAGCGGAAGCAGCTTGCC
TACGTGAAAGATGGCGTGACAGTACTTGCCGTCGACAACTCTTCTTCCGTGCCCGTCGGTGGCAAACGCGACTCG
GTTCGTATTACAACGAAGAAAACTTGGAACTTTGGTCTCTTCATTGCTGATTTCGCCTATATGCCATGGGGATGC
GGCATATGGCCCGCGTACTGGAGCGTCGGTCCTGATTGGCCTAACGCTGGCGAGATAGACATCCTTGAGGGTGTG
AACAACCAAACCTGGAATCAGTATACCATCCACACCGGGATTGAATGTGTCCTTCCGGATAATAGTGCGGGTATC
GATGCCCTGGCCTCACCCATGGGTAAGACCTGTACGAGTTCCAATGGTGCCAACAGTGGTTGTGGTTACCAAAAT
AATAATCCAAATTCATATGGGGCAGGATTCAATGCCGCTGGCGGAGGCGTCCTCGTTCACGAGTGGAATAGTTGG
GGTGTCAAGATCTGGTTCTTTACCCGTGATAGTATTCCTGTGGATATCACCAACGAACAGCCTAACCCAACTTCT
TGGGGAACCCCTACGGCGGCTTGGCCTTCTCGGGATTGCGATTTTTCGTCGGCCTTGTATGAACACTCTTTGGTC
ATCGATACTACGCTTTGCGGTGATTGGGCCGGATCTGCATATGGTGATTCTGGCTGCCCGGGCACGTGTCAAGAG
GTGGTCGCGAATCCAGCCAACTTCGCTAACGCGCAATGGGGCGTAAACTATATCTCCGTTTATCAGTCTTGA
Transcript >AgabiH97|092210
ATGCGCTTTTATTATACACTCATTGCGACTTTTCTTCCAGTCTTTGCACTTGCCGGCAAGTCTTACGACACCCAT
TTGCGTTCCCGACATGCCAGTCGCGCGGCGGGACTACGTATCCGAGCAGACGATACTTATGTACCCAACGCGACT
GTCAGTAATGGAAACCCTCCATATCATCGACATGAGCATTATGAAGGGGAATCATTTTTTAAGGAATGGGATTTT
TTCACCGGAGAAGATCCAACCCATGGAAATGTGAATTATCAATCACTCAGTAACGCTCAGCGGAAGCAGCTTGCC
TACGTGAAAGATGGCGTGACAGTACTTGCCGTCGACAACTCTTCTTCCGTGCCCGTCGGTGGCAAACGCGACTCG
GTTCGTATTACAACGAAGAAAACTTGGAACTTTGGTCTCTTCATTGCTGATTTCGCCTATATGCCATGGGGATGC
GGCATATGGCCCGCGTACTGGAGCGTCGGTCCTGATTGGCCTAACGCTGGCGAGATAGACATCCTTGAGGGTGTG
AACAACCAAACCTGGAATCAGTATACCATCCACACCGGGATTGAATGTGTCCTTCCGGATAATAGTGCGGGTATC
GATGCCCTGGCCTCACCCATGGGTAAGACCTGTACGAGTTCCAATGGTGCCAACAGTGGTTGTGGTTACCAAAAT
AATAATCCAAATTCATATGGGGCAGGATTCAATGCCGCTGGCGGAGGCGTCCTCGTTCACGAGTGGAATAGTTGG
GGTGTCAAGATCTGGTTCTTTACCCGTGATAGTATTCCTGTGGATATCACCAACGAACAGCCTAACCCAACTTCT
TGGGGAACCCCTACGGCGGCTTGGCCTTCTCGGGATTGCGATTTTTCGTCGGCCTTGTATGAACACTCTTTGGTC
ATCGATACTACGCTTTGCGGTGATTGGGCCGGATCTGCATATGGTGATTCTGGCTGCCCGGGCACGTGTCAAGAG
GTGGTCGCGAATCCAGCCAACTTCGCTAACGCGCAATGGGGCGTAAACTATATCTCCGTTTATCAGTCTTGA
Gene >AgabiH97|092210
ATGCGCTTTTATTATACACTCATTGCGACTTTTCTTCCAGTCTTTGCACTTGCCGGCAAGTCTTACGACACCCAT
TTGCGTTCCCGACATGCCAGTCGCGCGGCGGGACTACGTATCCGAGCAGACGATACTTATGTACCCAACGCGACT
GTCAGTAATGGAAACCCTCCATATCATCGACATGAGCATTATGAAGGGGAATCATTTTTTAAGTGAGCCTTGTAT
CTGAAATACATTCACTCTTTAACTGATCGACCGTTGTCGACTCGAAGGGAATGGGATTTTTTCACCGGAGAAGAT
CCAACCCATGGAAATGTGAATTATCAATCACTCAGTAACGCTCAGCGGAAGCAGCTTGCCTACGTGAAAGATGGC
GTGACAGTACTTGCCGTCGACAACTCTTCTTCCGTGCCCGTCGGTGGCAAACGCGACTCGTGAGTTGCAAATCCT
TTTGACACGTCCTGTCAGTCAAAATTAATTAAGCATCTTATTTCGGTGACCTCGAATAGGGTTCGTATTACAACG
AAGAAAACTTGGAACTTTGGTCTCTTCATTGCTGATTTCGCCTATATGCCATGGGGATGCGGCATATGGCCCGCG
TACTGGAGCGTCGGTCCTGATTGGCCTAACGCTGGCGAGATAGACATCCTTGAGGGTGTGAACAACCAAACCTGG
AATCAGTATACCATCCACACCGGGATTGAATGTGTCCTTCCGGATAATAGTGCGGGTATCGATGCCCTGGCCTCA
CCCATGGGTAAGACCTGTACGAGTTCCAATGGTGCCAACAGTGGTTGTGGTTACCAAAATAATAATCCAAATTCA
TATGGGGCAGGATTCAATGCCGCTGGCGGAGGCGTCCTCGTTCACGAGTGGAATAGTTGGGGTGTCAAGATCTGG
TTCTTTACCCGTGATAGTATTCCTGTGGATATCACCAACGAACAGCCTAACCCAACTTCTTGGGGAACCCCTACG
GCGGCTTGGCCTTCTCGGGATTGCGATTTTTCGTCGGCCTTGTATGAACACTCTTTGGTCATCGATACTACGCTT
TGCGGTGATTGGGCCGGATCTGCATATGGTGATTCTGGCTGCCCGGGCACGTGTCAAGAGGTGGTCGCGAATCCA
GCCAACTTCGCTAGTACGTTCCCTCTCTTATGCCCCGCATGTATTTGATGACTTACCAACGATTGCTTAGACGCG
CAATGGGGCGTAAACTATATCTCCGTTTATCAGTCTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail