Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092160
Gene name
Locationscaffold_6:1029046..1031456
Strand+
Gene length (bp)2410
Transcript length (bp)1881
Coding sequence length (bp)1881
Protein length (aa) 627

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF04818 CID CID domain 2.3E-08 18 141

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q9UTE3|SEB1_SCHPO Rpb7-binding protein seb1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=seb1 PE=1 SV=3 1 227 4.0E-13
sp|P53617|NRD1_YEAST Protein NRD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=NRD1 PE=1 SV=1 4 212 1.0E-09
sp|Q63623|SCAF8_RAT Protein SCAF8 OS=Rattus norvegicus GN=Scaf8 PE=1 SV=1 1 210 2.0E-06
sp|Q6DID3|SCAF8_MOUSE Protein SCAF8 OS=Mus musculus GN=Scaf8 PE=1 SV=1 1 210 2.0E-06
sp|Q9UPN6|SCAF8_HUMAN Protein SCAF8 OS=Homo sapiens GN=SCAF8 PE=1 SV=1 1 210 5.0E-06

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092160
MSTVQDFDTTFNEVVQAKRLSQSKMAKLTELALKLMDQDTQLVATMYRSHKMLPAPCKISSLYVFDALARAARQQ
VIKQNLSERHATGNCATFLSKVAGVLEGLFQDILAAGLPEAKEKTRKIYDIWVKGNTFPPDILSRLLDVVSGKDK
VTEVNTSVTADPRIVSQMNSTIPPQSPVAPTSTDTQATLLALLTQAASHQVPQTTTNTAVTPTAPLDPASLAILQ
YLQTASVNNTATSQISPTSAEASDTRITQNATDRQISNSPAPHVEPNHARQDNRRDYRSPPQSGHSYERDYDKRS
HSYKESRGGFRRRGRRNRWDEREPLTQRDQQETGWSPRSGGRSRSHSPDGRTHRRPPPVPRSNSQRQSSPSASRH
HGDSSTSHPLNSSSEKDEFGRDLRSPSPSKSPNPGLTSNQHNSTSPNTPSVSHFPKSEFSSTSTSNDRMSRSSVA
ANTFPKEPDAFETSHESSSKTGHEVGMGNFDISTFDPTSPASWEAMGKMWEITNGYQPSTEELMQFVMMGTMSQQ
LQSKNWQQGDALMGYGNDQRRGGGSGEHGNSRSNHHGWANDGMDSSTDAIVLGGGEMEMDESAESEGPQRQEPVD
SGTRPGGKMQKVGDRWVFVRSDTGVR*
Coding >AgabiH97|092160
ATGTCGACTGTACAGGATTTTGACACAACATTCAACGAGGTCGTTCAAGCCAAGAGATTGTCCCAATCCAAGATG
GCGAAACTCACTGAGCTAGCCCTGAAGCTCATGGACCAGGATACGCAGCTTGTCGCGACAATGTATCGGTCTCAC
AAAATGTTACCAGCACCTTGCAAGATCTCGAGTCTCTATGTGTTCGATGCGCTAGCTAGAGCAGCCAGACAGCAG
GTTATCAAGCAAAATCTATCAGAGCGTCATGCGACTGGAAATTGTGCCACATTTCTCTCAAAGGTGGCGGGGGTC
CTTGAGGGTCTATTTCAAGATATACTTGCTGCTGGCCTCCCCGAAGCAAAGGAAAAAACCAGAAAAATTTATGAT
ATCTGGGTGAAGGGGAACACATTTCCTCCAGATATTCTCAGTCGTTTATTGGACGTAGTATCGGGAAAAGATAAA
GTGACCGAAGTGAATACCTCAGTGACAGCCGATCCCCGCATCGTATCTCAAATGAATTCTACTATTCCTCCTCAA
AGCCCCGTTGCACCAACTTCCACGGACACTCAGGCAACATTGCTTGCTCTACTAACGCAAGCTGCCAGTCACCAA
GTTCCGCAAACAACCACAAATACTGCAGTGACACCTACAGCGCCTCTCGATCCTGCGTCACTCGCTATCTTGCAG
TATTTACAAACAGCGTCCGTCAATAACACGGCTACAAGCCAAATATCACCTACCTCAGCAGAAGCATCAGATACC
CGTATAACACAGAATGCTACAGATCGTCAAATATCAAACTCACCTGCGCCTCATGTTGAGCCTAACCATGCTAGG
CAGGACAACAGGCGTGATTATCGTAGTCCACCTCAAAGCGGTCATTCTTATGAGAGAGACTATGATAAAAGAAGC
CACTCCTACAAAGAAAGTAGGGGCGGCTTTCGTCGACGCGGACGCCGGAATCGTTGGGACGAACGAGAGCCCCTT
ACTCAACGAGACCAGCAAGAAACTGGCTGGAGTCCGCGTAGCGGAGGGCGTAGTCGGTCACACAGTCCAGATGGC
CGAACGCACAGGAGGCCTCCACCAGTGCCTCGCTCGAATTCTCAACGACAGTCATCCCCTTCTGCATCTCGACAT
CATGGTGATAGTTCTACGTCTCATCCACTCAATAGCAGTTCCGAAAAGGATGAATTCGGTCGCGATTTGCGATCA
CCTTCACCTTCCAAATCTCCTAATCCTGGTCTTACTTCGAACCAACACAACAGTACCTCTCCAAACACACCCTCA
GTGTCTCATTTCCCGAAATCAGAGTTCTCATCTACGTCTACAAGTAATGACCGGATGTCTAGATCGTCGGTAGCT
GCGAATACATTTCCGAAGGAACCTGATGCCTTTGAAACATCTCACGAATCGAGTAGCAAAACCGGACATGAAGTT
GGGATGGGGAACTTTGATATATCGACATTTGACCCTACTTCACCTGCTTCGTGGGAAGCAATGGGGAAGATGTGG
GAGATAACGAATGGATACCAGCCCTCCACAGAGGAGTTGATGCAATTTGTGATGATGGGTACCATGAGTCAACAA
CTCCAATCAAAGAATTGGCAGCAAGGAGATGCGCTAATGGGGTACGGCAATGACCAAAGACGAGGGGGAGGCAGC
GGAGAGCACGGCAACAGCCGAAGTAATCACCACGGATGGGCTAATGACGGGATGGACAGTTCGACGGATGCTATT
GTCCTGGGAGGTGGTGAGATGGAAATGGATGAGTCTGCAGAAAGTGAAGGTCCACAAAGGCAGGAACCAGTAGAT
TCAGGGACTCGACCTGGAGGAAAGATGCAAAAAGTGGGAGACAGATGGGTGTTTGTTCGCAGTGATACTGGTGTA
CGGTGA
Transcript >AgabiH97|092160
ATGTCGACTGTACAGGATTTTGACACAACATTCAACGAGGTCGTTCAAGCCAAGAGATTGTCCCAATCCAAGATG
GCGAAACTCACTGAGCTAGCCCTGAAGCTCATGGACCAGGATACGCAGCTTGTCGCGACAATGTATCGGTCTCAC
AAAATGTTACCAGCACCTTGCAAGATCTCGAGTCTCTATGTGTTCGATGCGCTAGCTAGAGCAGCCAGACAGCAG
GTTATCAAGCAAAATCTATCAGAGCGTCATGCGACTGGAAATTGTGCCACATTTCTCTCAAAGGTGGCGGGGGTC
CTTGAGGGTCTATTTCAAGATATACTTGCTGCTGGCCTCCCCGAAGCAAAGGAAAAAACCAGAAAAATTTATGAT
ATCTGGGTGAAGGGGAACACATTTCCTCCAGATATTCTCAGTCGTTTATTGGACGTAGTATCGGGAAAAGATAAA
GTGACCGAAGTGAATACCTCAGTGACAGCCGATCCCCGCATCGTATCTCAAATGAATTCTACTATTCCTCCTCAA
AGCCCCGTTGCACCAACTTCCACGGACACTCAGGCAACATTGCTTGCTCTACTAACGCAAGCTGCCAGTCACCAA
GTTCCGCAAACAACCACAAATACTGCAGTGACACCTACAGCGCCTCTCGATCCTGCGTCACTCGCTATCTTGCAG
TATTTACAAACAGCGTCCGTCAATAACACGGCTACAAGCCAAATATCACCTACCTCAGCAGAAGCATCAGATACC
CGTATAACACAGAATGCTACAGATCGTCAAATATCAAACTCACCTGCGCCTCATGTTGAGCCTAACCATGCTAGG
CAGGACAACAGGCGTGATTATCGTAGTCCACCTCAAAGCGGTCATTCTTATGAGAGAGACTATGATAAAAGAAGC
CACTCCTACAAAGAAAGTAGGGGCGGCTTTCGTCGACGCGGACGCCGGAATCGTTGGGACGAACGAGAGCCCCTT
ACTCAACGAGACCAGCAAGAAACTGGCTGGAGTCCGCGTAGCGGAGGGCGTAGTCGGTCACACAGTCCAGATGGC
CGAACGCACAGGAGGCCTCCACCAGTGCCTCGCTCGAATTCTCAACGACAGTCATCCCCTTCTGCATCTCGACAT
CATGGTGATAGTTCTACGTCTCATCCACTCAATAGCAGTTCCGAAAAGGATGAATTCGGTCGCGATTTGCGATCA
CCTTCACCTTCCAAATCTCCTAATCCTGGTCTTACTTCGAACCAACACAACAGTACCTCTCCAAACACACCCTCA
GTGTCTCATTTCCCGAAATCAGAGTTCTCATCTACGTCTACAAGTAATGACCGGATGTCTAGATCGTCGGTAGCT
GCGAATACATTTCCGAAGGAACCTGATGCCTTTGAAACATCTCACGAATCGAGTAGCAAAACCGGACATGAAGTT
GGGATGGGGAACTTTGATATATCGACATTTGACCCTACTTCACCTGCTTCGTGGGAAGCAATGGGGAAGATGTGG
GAGATAACGAATGGATACCAGCCCTCCACAGAGGAGTTGATGCAATTTGTGATGATGGGTACCATGAGTCAACAA
CTCCAATCAAAGAATTGGCAGCAAGGAGATGCGCTAATGGGGTACGGCAATGACCAAAGACGAGGGGGAGGCAGC
GGAGAGCACGGCAACAGCCGAAGTAATCACCACGGATGGGCTAATGACGGGATGGACAGTTCGACGGATGCTATT
GTCCTGGGAGGTGGTGAGATGGAAATGGATGAGTCTGCAGAAAGTGAAGGTCCACAAAGGCAGGAACCAGTAGAT
TCAGGGACTCGACCTGGAGGAAAGATGCAAAAAGTGGGAGACAGATGGGTGTTTGTTCGCAGTGATACTGGTGTA
CGGTGA
Gene >AgabiH97|092160
ATGTCGACTGTACAGGTATCTATTCAGCTTTTCATTTGATTCGTTGCTCAAGATCACGTTAAGGATTTTGACACA
ACATTCAACGAGGTCGTTCAAGCCAAGAGATTGTCCCAATCCAAGATGGCGAAACTCACTGAGCTAGCCCTGAAG
CTCATGGACGTGTGTATCGTTGCCTTCCCTTTTTTTCTTTCGTTCTCTTTTGTTTTGGCCCATGTTCACATCTAT
GTTTCGTCTCCAGCAGGATACGCAGCTTGTCGCGACAATGTATCGGTCTCACAAAATGTTACCAGCACCTTGCAA
GATCTCGAGTCTCTATGTGTTCGATGCGCTAGCTAGAGCAGCCAGACAGCAGGTTATCAAGCAAAATCTATCAGA
GCGTCATGCGACTGGAAATTGTGCCACATTTCTCTCAAAGGTGGCGGGGGTCCTTGAGGGTCTATTTCAAGATAT
ACTTGCTGCTGGCCTCCCCGAAGCAAAGGTCAGTGTTGCCGGAACTGCATACGGACGTCCCATGCGCCTATACGA
GGTTGTTAAATATCATTTTACGTTCCACTTACGGTTGGCTGTGTGTCTTTGATACCTTGCCCCAGGCATTTGTCG
CGTACTAGGATCAGGATGGCGTGTTTTAGTCACTAGGGCAGGCGCTCAGACTCCTGATTTTCCGCTTTTGATGAT
TAAGGTAGTCACGGTCCTAACCTTTCATTCTCGCAGGAAAAAACCAGAAAAATTTATGATATCTGGGTGAAGGGG
AACACATTTCCTCCAGATATTCTCAGTCGTTTATTGGACGTAGTATCGGGAAAAGATAAAGGTGCATATCAATTT
TTGTTGTACGCTGAGTATCTTCTCTGTCTATATAATTGTTTCCCCAAATTTCTCCAAGTTCGGCCGAAGGGATGA
TGCTAAATCGACGTTGGTTTGTTCAATGTTAGTGACCGAAGTGAATACCTCAGTGACAGCCGATCCCCGCATCGT
ATCTCAAATGAATTCTACTATTCCTCCTCAAAGCCCCGTTGCACCAACTTCCACGGACACTCAGGCAACATTGCT
TGCTCTACTAACGCAAGCTGCCAGTCACCAAGTTCCGTGAGTCGTGTTCAGTCCTTTTCTCTAGACACCATCTTA
GTCCGTTAGGCAAACAACCACAAATACTGCAGTGACACCTACAGCGCCTCTCGATCCTGCGTCACTCGCTATCTT
GCAGTATTTACAAACAGCGTCCGTCAATAACACGGCTACAAGCCAAATATCACCTACCTCAGCAGAAGCATCAGA
TACCCGTATAACACAGAATGCTACAGATCGTCAAATATCAAACTCACCTGCGCCTCATGTTGAGCCTAACCATGC
TAGGCAGGACAACAGGCGTGATTATCGTAGTCCACCTCAAAGCGGTCATTCTTATGAGAGAGACTATGATAAAAG
AAGCCACTCCTACAAAGAAAGTAGGGGCGGCTTTCGTCGACGCGGACGCCGGAATCGTTGGGACGAACGAGAGCC
CCTTACTCAACGAGACCAGCAAGAAACTGGCTGGAGTCCGCGTAGCGGAGGGCGTAGTCGGTCACACAGTCCAGA
TGGCCGAACGCACAGGAGGCCTCCACCAGTGCCTCGCTCGAATTCTCAACGACAGTCATCCCCTTCTGCATCTCG
ACATCATGGTGATAGTTCTACGTCTCATCCACTCAATAGCAGTTCCGAAAAGGATGAATTCGGTCGCGATTTGCG
ATCACCTTCACCTTCCAAATCTCCTAATCCTGGTCTTACTTCGAACCAACACAACAGTACCTCTCCAAACACACC
CTCAGTGTCTCATTTCCCGAAATCAGAGTTCTCATCTACGTCTACAAGTAATGACCGGATGTCTAGATCGTCGGT
AGCTGCGAATACATTTCCGAAGGAACCTGATGCCTTTGAAACATCTCACGAATCGAGTAGCAAAACCGGACATGA
AGTTGGGATGGGGAACTTTGATATATCGACATTTGACCCTACTTCACCTGCTTCGTGGGAAGCAATGGGGAAGAT
GTGGGAGATAACGAATGGATACCAGCCCTCCACAGAGGAGTTGATGCAATTTGTGATGATGGGTACCATGAGTCA
ACAACTCCAATCAAAGAATTGGCAGCAAGGAGATGCGCTAATGGGGTACGGCAATGACCAAAGACGAGGGGGAGG
CAGCGGAGAGCACGGCAACAGCCGAAGTAATCACCACGGATGGGCTAATGACGGGATGGACAGTTCGACGGATGC
TATTGTCCTGGGAGGTGGTGAGATGGAAATGGATGAGTCTGCAGAAAGTGAAGGTCCACAAAGGCAGGAACCAGT
AGATTCAGGGACTCGACCTGGAGGAAAGATGCAAAAAGTGGGAGACAGATGGGTGTTTGTTCGCAGTGATACTGG
TGTACGGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail