Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092100
Gene name
Locationscaffold_6:1015033..1016928
Strand+
Gene length (bp)1895
Transcript length (bp)1089
Coding sequence length (bp)1089
Protein length (aa) 363

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01545 Cation_efflux Cation efflux family 7.7E-45 11 242

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 6 322 2.0E-59
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 1 322 8.0E-57
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 6 336 1.0E-55
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 3 321 9.0E-43
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 2 326 3.0E-34
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P20107|ZRC1_YEAST Zinc/cadmium resistance protein OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ZRC1 PE=1 SV=2 6 322 2.0E-59
sp|O13918|ZHF1_SCHPO Zinc homeostasis factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=zhf1 PE=2 SV=3 1 322 8.0E-57
sp|P32798|COT1_YEAST Cobalt uptake protein COT1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=COT1 PE=1 SV=2 6 336 1.0E-55
sp|Q3UVU3|ZNT10_MOUSE Zinc transporter 10 OS=Mus musculus GN=Slc30a10 PE=1 SV=1 3 321 9.0E-43
sp|O35149|ZNT4_MOUSE Zinc transporter 4 OS=Mus musculus GN=Slc30a4 PE=1 SV=2 2 326 3.0E-34
sp|O55174|ZNT4_RAT Zinc transporter 4 OS=Rattus norvegicus GN=Slc30a4 PE=2 SV=1 2 327 2.0E-33
sp|O14863|ZNT4_HUMAN Zinc transporter 4 OS=Homo sapiens GN=SLC30A4 PE=2 SV=2 2 326 1.0E-30
sp|Q60738|ZNT1_MOUSE Zinc transporter 1 OS=Mus musculus GN=Slc30a1 PE=1 SV=1 2 329 2.0E-30
sp|Q62720|ZNT1_RAT Zinc transporter 1 OS=Rattus norvegicus GN=Slc30a1 PE=2 SV=1 2 329 3.0E-30
sp|A7Z1S6|CZCD_BACMF Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=czcD PE=3 SV=1 2 321 3.0E-28
sp|O07084|CZCD_BACSU Cadmium, cobalt and zinc/H(+)-K(+) antiporter OS=Bacillus subtilis (strain 168) GN=czcD PE=1 SV=1 2 332 5.0E-27
sp|Q8H329|MTP8_ORYSJ Metal tolerance protein 8 OS=Oryza sativa subsp. japonica GN=MTP8 PE=2 SV=2 2 321 9.0E-27
sp|Q5XHB4|ZNT8_XENTR Zinc transporter 8 OS=Xenopus tropicalis GN=slc30a8 PE=2 SV=1 6 327 8.0E-26
sp|Q5I020|ZNT8_XENLA Zinc transporter 8 OS=Xenopus laevis GN=slc30a8 PE=2 SV=1 6 286 2.0E-25
sp|Q54QU8|Y3629_DICDI Probable zinc transporter protein DDB_G0283629 OS=Dictyostelium discoideum GN=DDB_G0283629 PE=3 SV=1 2 321 8.0E-25
sp|Q8R4H9|ZNT5_MOUSE Zinc transporter 5 OS=Mus musculus GN=Slc30a5 PE=1 SV=1 3 321 2.0E-24
sp|Q54F34|Y1141_DICDI Probable zinc transporter protein DDB_G0291141 OS=Dictyostelium discoideum GN=DDB_G0291141 PE=3 SV=1 4 306 1.0E-22
sp|Q8TAD4|ZNT5_HUMAN Zinc transporter 5 OS=Homo sapiens GN=SLC30A5 PE=1 SV=1 3 321 1.0E-22
sp|Q2HJ10|ZNT2_MOUSE Zinc transporter 2 OS=Mus musculus GN=Slc30a2 PE=2 SV=1 13 288 1.0E-22
sp|Q08E25|ZNT3_BOVIN Zinc transporter 3 OS=Bos taurus GN=SLC30A3 PE=2 SV=1 1 290 2.0E-22
sp|Q5ZLF4|ZNT5_CHICK Zinc transporter 5 OS=Gallus gallus GN=SLC30A5 PE=2 SV=1 3 321 6.0E-22
sp|Q9M271|MTPA1_ARATH Metal tolerance protein A1 OS=Arabidopsis thaliana GN=MTPA1 PE=2 SV=1 6 321 1.0E-21
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 3 132 3.0E-21
sp|Q6QIX3|ZNT3_RAT Zinc transporter 3 OS=Rattus norvegicus GN=Slc30a3 PE=1 SV=1 12 326 7.0E-21
sp|Q9ZT63|MTP1_ARATH Metal tolerance protein 1 OS=Arabidopsis thaliana GN=MTP1 PE=1 SV=2 6 321 7.0E-21
sp|Q99726|ZNT3_HUMAN Zinc transporter 3 OS=Homo sapiens GN=SLC30A3 PE=1 SV=2 12 290 8.0E-21
sp|Q5R617|ZNT3_PONAB Zinc transporter 3 OS=Pongo abelii GN=SLC30A3 PE=2 SV=1 12 290 1.0E-20
sp|Q8Z8B6|ZITB_SALTI Zinc transporter ZitB OS=Salmonella typhi GN=zitB PE=3 SV=1 2 323 1.0E-20
sp|P13512|CZCD_CUPMC Metal cation efflux system protein CzcD OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=czcD PE=1 SV=2 3 326 2.0E-20
sp|P94178|CZCD_ALCSC Cation efflux system protein CzcD OS=Alcaligenes sp. (strain CT14) GN=czcD PE=3 SV=1 3 326 2.0E-20
sp|A4IFD7|ZNT7_BOVIN Zinc transporter 7 OS=Bos taurus GN=SLC30A7 PE=2 SV=1 2 288 3.0E-20
sp|Q9SI03|MTP12_ARATH Metal tolerance protein 12 OS=Arabidopsis thaliana GN=MTP12 PE=3 SV=1 2 292 1.0E-19
sp|Q8IWU4|ZNT8_HUMAN Zinc transporter 8 OS=Homo sapiens GN=SLC30A8 PE=1 SV=2 13 320 2.0E-19
sp|Q8NEW0|ZNT7_HUMAN Zinc transporter 7 OS=Homo sapiens GN=SLC30A7 PE=2 SV=1 2 288 5.0E-19
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 176 322 6.0E-19
sp|P97441|ZNT3_MOUSE Zinc transporter 3 OS=Mus musculus GN=Slc30a3 PE=1 SV=1 17 290 1.0E-18
sp|Q8ZQT3|ZITB_SALTY Zinc transporter ZitB OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=zitB PE=3 SV=1 2 323 1.0E-18
sp|Q6DG36|ZNT5_DANRE Zinc transporter 5 OS=Danio rerio GN=slc30a5 PE=2 SV=1 3 321 2.0E-18
sp|Q28CE7|ZNT5_XENTR Zinc transporter 5 OS=Xenopus tropicalis GN=slc30a5 PE=2 SV=1 3 321 2.0E-18
sp|Q6DBM8|MTPB_ARATH Metal tolerance protein B OS=Arabidopsis thaliana GN=MTPB PE=2 SV=1 2 321 4.0E-18
sp|Q9LXS1|MTPA2_ARATH Metal tolerance protein A2 OS=Arabidopsis thaliana GN=MTPA2 PE=2 SV=2 17 321 9.0E-18
sp|Q688R1|MTP1_ORYSJ Metal tolerance protein 1 OS=Oryza sativa subsp. japonica GN=MTP1 PE=2 SV=1 1 321 1.0E-17
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 2 135 2.0E-17
sp|Q5MNV6|ZNT7_CHICK Zinc transporter 7 OS=Gallus gallus GN=SLC30A7 PE=2 SV=1 2 288 2.0E-17
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 2 135 2.0E-17
sp|Q8ZGY6|ZITB_YERPE Zinc transporter ZitB OS=Yersinia pestis GN=zitB PE=3 SV=1 2 323 2.0E-17
sp|Q6XR72|ZNT10_HUMAN Zinc transporter 10 OS=Homo sapiens GN=SLC30A10 PE=1 SV=2 177 321 4.0E-17
sp|Q62941|ZNT2_RAT Zinc transporter 2 OS=Rattus norvegicus GN=Slc30a2 PE=2 SV=1 13 288 8.0E-17
sp|Q66D85|ZITB_YERPS Zinc transporter ZitB OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=zitB PE=3 SV=1 2 323 2.0E-16
sp|Q83SA2|ZITB_SHIFL Zinc transporter ZitB OS=Shigella flexneri GN=zitB PE=3 SV=1 2 321 6.0E-16
sp|Q8BGG0|ZNT8_MOUSE Zinc transporter 8 OS=Mus musculus GN=Slc30a8 PE=2 SV=1 13 286 6.0E-16
sp|P75757|ZITB_ECOLI Zinc transporter ZitB OS=Escherichia coli (strain K12) GN=zitB PE=1 SV=1 2 321 7.0E-16
sp|Q8X400|ZITB_ECO57 Zinc transporter ZitB OS=Escherichia coli O157:H7 GN=zitB PE=3 SV=1 2 323 8.0E-16
sp|P0CE46|ZNT8_RAT Zinc transporter 8 OS=Rattus norvegicus GN=Slc30a8 PE=1 SV=1 13 286 9.0E-16
sp|Q5BJM8|ZNT7_RAT Zinc transporter 7 OS=Rattus norvegicus GN=Slc30a7 PE=2 SV=2 2 288 2.0E-14
sp|Q9JKN1|ZNT7_MOUSE Zinc transporter 7 OS=Mus musculus GN=Slc30a7 PE=1 SV=1 2 288 2.0E-14
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 18 128 3.0E-12
sp|Q4R6K2|ZNT1_MACFA Zinc transporter 1 OS=Macaca fascicularis GN=SLC30A1 PE=2 SV=1 176 329 7.0E-12
sp|Q9Y6M5|ZNT1_HUMAN Zinc transporter 1 OS=Homo sapiens GN=SLC30A1 PE=1 SV=3 176 329 8.0E-12
sp|Q54T06|Y8206_DICDI Probable zinc transporter protein DDB_G0282067 OS=Dictyostelium discoideum GN=DDB_G0282067 PE=2 SV=1 4 129 4.0E-11
sp|Q95QW4|CDF1_CAEEL Cation diffusion facilitator family protein 1 OS=Caenorhabditis elegans GN=cdf-1 PE=1 SV=1 176 330 9.0E-11
sp|Q55E98|Y9332_DICDI Probable zinc transporter protein DDB_G0269332 OS=Dictyostelium discoideum GN=DDB_G0269332 PE=3 SV=1 3 286 2.0E-10
sp|Q9BRI3|ZNT2_HUMAN Zinc transporter 2 OS=Homo sapiens GN=SLC30A2 PE=1 SV=1 74 292 2.0E-10
sp|Q6D7E5|ZITB_PECAS Zinc transporter ZitB OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=zitB PE=3 SV=1 3 327 6.0E-09
sp|A5PMX1|ZNT7_DANRE Zinc transporter 7 OS=Danio rerio GN=slc30a7 PE=2 SV=1 2 131 4.0E-08
sp|Q52KD7|ZNT7A_XENLA Zinc transporter 7-A OS=Xenopus laevis GN=slc30a7-a PE=2 SV=1 11 131 5.0E-08
sp|Q03455|MSC2_YEAST Probable zinc transporter MSC2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MSC2 PE=1 SV=2 2 203 6.0E-08
sp|Q9HGQ3|CIS4_SCHPO Probable zinc transporter cis4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=cis4 PE=1 SV=1 2 127 5.0E-07
sp|Q6NRI1|ZNT7B_XENLA Zinc transporter 7-B OS=Xenopus laevis GN=slc30a7-b PE=2 SV=1 157 288 3.0E-06
sp|Q6P3N9|ZNT7_XENTR Zinc transporter 7 OS=Xenopus tropicalis GN=slc30a7 PE=2 SV=1 156 288 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008324 cation transmembrane transporter activity Yes
GO:0006812 cation transport Yes
GO:0016021 integral component of membrane Yes
GO:0055085 transmembrane transport Yes
GO:0031224 intrinsic component of membrane No
GO:0110165 cellular anatomical entity No
GO:0005215 transporter activity No
GO:0009987 cellular process No
GO:0008150 biological_process No
GO:0015075 ion transmembrane transporter activity No
GO:0022857 transmembrane transporter activity No
GO:0006810 transport No
GO:0051234 establishment of localization No
GO:0051179 localization No
GO:0006811 ion transport No
GO:0003674 molecular_function No
GO:0005575 cellular_component No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 7 26 19
2 75 97 22
3 109 131 22
4 182 204 22
5 216 235 19

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092100
MKNTTKIGFVLVISLAFFCAEIAVGFRTKSLALIADALHYLNDIVAYTIAFIAAYLQDSGQHTVKFTFAFHRAEL
VGAFFNGVFLLALAISILLQSIERFVHLEEITEPSLVLIIGCVGLGLNILSVFVVHDHHGHGGHGHGQPIQMNDL
NPNTCDHVHATHNHTIDPPISSHQHNLGLLGVLVHLCGDAVNNLAVIVAAIIIWKLDAHSRFYADPAVSLAISFI
IFASAIPMTWKTGRILLEAVPLYIDLAKVKEDLLAIPDVLSIHDLHVWHLSQSVILASLHVCVPSGTSLVHWEQI
EQTLQHCFQAYGISHVTISPELRRSESHSLSNEKGGCIRLSSEDDIGCSVNEFKKRRLIGDV*
Coding >AgabiH97|092100
ATGAAAAACACTACGAAGATTGGCTTCGTCTTAGTGATCAGCTTGGCATTCTTTTGCGCAGAAATTGCAGTGGGT
TTCAGAACGAAGAGTCTGGCTCTCATTGCTGATGCGCTCCACTACCTGAATGACATCGTGGCTTATACCATCGCC
TTCATTGCTGCATATTTGCAAGACAGCGGACAACATACTGTGAAATTTACTTTTGCCTTTCATCGCGCAGAACTC
GTTGGCGCATTTTTCAATGGTGTCTTCCTCCTGGCGTTAGCCATTTCTATCCTTCTTCAATCTATTGAGCGGTTC
GTCCATTTGGAGGAAATCACTGAGCCATCCTTGGTGTTGATTATTGGCTGTGTCGGCTTGGGTCTCAATATACTA
AGCGTTTTCGTGGTCCACGACCATCATGGTCATGGTGGTCATGGGCATGGTCAGCCGATACAGATGAACGATCTA
AATCCGAATACTTGCGATCATGTACATGCGACTCATAATCATACCATCGATCCGCCGATCAGTTCTCATCAACAT
AATCTCGGACTACTCGGAGTCTTGGTTCACCTATGCGGTGACGCTGTAAACAATCTAGCGGTGATCGTAGCTGCC
ATCATCATATGGAAGCTAGACGCACATAGTCGGTTTTATGCTGATCCAGCCGTTTCTCTGGCTATCAGTTTTATT
ATATTCGCGAGTGCGATTCCCATGACCTGGAAAACGGGTCGAATCCTTTTGGAAGCCGTGCCACTCTACATTGAT
CTCGCCAAAGTCAAAGAGGACTTGCTTGCGATTCCTGATGTTTTGTCTATTCATGATCTTCATGTCTGGCATCTC
TCTCAATCCGTGATTCTGGCTTCCTTACACGTATGCGTGCCGTCCGGTACCTCCTTGGTACACTGGGAACAAATC
GAACAAACGCTACAGCACTGTTTTCAAGCATACGGAATCAGTCATGTCACAATCTCTCCAGAACTACGGCGCTCC
GAATCTCACTCACTTTCGAACGAAAAGGGAGGTTGCATTCGACTCTCATCTGAAGATGATATCGGGTGTTCCGTC
AACGAATTCAAGAAACGGCGATTAATAGGAGATGTTTAA
Transcript >AgabiH97|092100
ATGAAAAACACTACGAAGATTGGCTTCGTCTTAGTGATCAGCTTGGCATTCTTTTGCGCAGAAATTGCAGTGGGT
TTCAGAACGAAGAGTCTGGCTCTCATTGCTGATGCGCTCCACTACCTGAATGACATCGTGGCTTATACCATCGCC
TTCATTGCTGCATATTTGCAAGACAGCGGACAACATACTGTGAAATTTACTTTTGCCTTTCATCGCGCAGAACTC
GTTGGCGCATTTTTCAATGGTGTCTTCCTCCTGGCGTTAGCCATTTCTATCCTTCTTCAATCTATTGAGCGGTTC
GTCCATTTGGAGGAAATCACTGAGCCATCCTTGGTGTTGATTATTGGCTGTGTCGGCTTGGGTCTCAATATACTA
AGCGTTTTCGTGGTCCACGACCATCATGGTCATGGTGGTCATGGGCATGGTCAGCCGATACAGATGAACGATCTA
AATCCGAATACTTGCGATCATGTACATGCGACTCATAATCATACCATCGATCCGCCGATCAGTTCTCATCAACAT
AATCTCGGACTACTCGGAGTCTTGGTTCACCTATGCGGTGACGCTGTAAACAATCTAGCGGTGATCGTAGCTGCC
ATCATCATATGGAAGCTAGACGCACATAGTCGGTTTTATGCTGATCCAGCCGTTTCTCTGGCTATCAGTTTTATT
ATATTCGCGAGTGCGATTCCCATGACCTGGAAAACGGGTCGAATCCTTTTGGAAGCCGTGCCACTCTACATTGAT
CTCGCCAAAGTCAAAGAGGACTTGCTTGCGATTCCTGATGTTTTGTCTATTCATGATCTTCATGTCTGGCATCTC
TCTCAATCCGTGATTCTGGCTTCCTTACACGTATGCGTGCCGTCCGGTACCTCCTTGGTACACTGGGAACAAATC
GAACAAACGCTACAGCACTGTTTTCAAGCATACGGAATCAGTCATGTCACAATCTCTCCAGAACTACGGCGCTCC
GAATCTCACTCACTTTCGAACGAAAAGGGAGGTTGCATTCGACTCTCATCTGAAGATGATATCGGGTGTTCCGTC
AACGAATTCAAGAAACGGCGATTAATAGGAGATGTTTAA
Gene >AgabiH97|092100
ATGAAAAACACTACGAAGATTGGCTTCGTCTTAGTGATCAGCTTGGCATTCTTTTGCGCAGAAATTGCAGGCGAG
CAACCTTATGCCGTCGTTGTCTTCTCATGAATAACATGTCAGCCTCGATCTCAGTGGGTTTCAGAACGAAGAGTC
TGGCTCTCATTGCTGATGCGGTTCGTCAGTTCCAAGGGGTTCTGTTCTGTATCAGCTGATATTATTCCAGCTCCA
CTACCTGAATGTGAGCCCGCGAGGCTGTAGATGTGTGACATTTCTGGCTCATGTTTGTCGTGCTGCGCATAACAG
GACATCGTGGCTTAGTGAGTCAGTGACTTCCGGAATGCTTCCGCTTATTCATATCACCGACACAGTACCATCGCC
TTCATTGCTGCATATGTACGTTCTTCTGCCAAGTTCTATGTAATAACAATCTAATGAATTCGCTGTCGACCCTCT
TAAGTTGCAAGACAGCGGACAACATGTTGGTTTTTATTCAATACACCAATTCATCCAATAGTCACCCATTAATTT
TGAATTTCTATTTTTAGACTGTGAAATTTACTTTTGCCTTTCATCGCGCAGAACTCGTTGGTAAGAATATATACT
CCGGGCCACATTCCGTCATTCATTTTTTCCACAGGCGCATTTTTCAATGGTGTCTTCCTCCTGGCGTTAGCCATT
TCTATCCTTCTTCAATCTATTGAGCGGTTCGTCCATTTGGAGGAAATCACTGAGCCATCCTTGGTGTTGATTATT
GGCTGTGTCGGCTTGGGTCTCAATATACTAAGCGTTTTCGTGGTCCACGGTATGTTCTCATCGCCGTTAGAGTGG
AATTCATAATTCTGATGCCATATTGCGAAAATATGGCAGACCATCATGGTCATGGTGGTCATGGGCATGGTCAGC
CGATACAGATGAACGATCTAAATCCGAATACTTGCGATCATGTAGTATGTTCACCCTCTTCTTTTCCTCATACAA
CCATTTGGAAACTGACTTTAGGGTTTTTTCAGCATGCGACTCATAATCATACCATCGATCCGCCGATCAGTTCTC
ATCAACATAATCTCGGACTACTCGGAGTCTTGGTTCACCTATGCGGTGACGCTGTAAACAGTAAGTTTTTTTCCA
ACACCAATATTACTGCGGAGTCCGACTCATCATGAATTGTGATGATTCGACAGATCTAGCGGTGATCGTAGCTGC
CATCATCATATGGAAGCTAGACGCACATAGTCGGTTTTATGCTGATCCAGCCGTTTCTCTGGCTATCAGTTTTAT
TATATTCGCGAGTGCGATTCCCATGAGTTGAGTGGCGCAGTTAACAGAAGGAAAAAGATATTAAAAATTCACTCT
TTTGCAGCCTGGAAAACGGGTCGAATCCTTTTGGAAGCCGTGCCACTCTACATTGATCTCGCCAAAGTCAAAGAG
GACTTGCTTGCGGTTCGTACAAGTTTATAGTATCGTAATGGTGCTAGCTCACATTTTTGTCTAGATTCCTGATGT
TTTGTCTATTCATGATCTTCATGTCTGGCATCTCTCTCAATCGTATGCCTATTTCTTTTTTTTTTGCGTTGTTCT
ACATTTTGCTCAACTCACTACCGATCGTATTTCCAAACCCCCGAATTCATTCCTGAACTCGTAGCGTGATTCTGG
CTTCCTTACACGTATGCGTGCCGTCCGGTACCTCCTTGGTACACTGGGAACAAATCGAACAAACGCTACAGCACT
GTTTTCAAGCATACGGAATCAGTCATGTCACAATCTCTCCAGAACTACGGCGCTCCGAATCTCACTCACTTTCGA
ACGAAAAGGGAGGTTGCATTCGACTCTCATCTGAAGATGATATCGGGTGTTCCGTCAACGAATTCAAGAAACGGC
GATTAATAGGAGATGTTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail