Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092070
Gene name
Locationscaffold_6:1008523..1010187
Strand+
Gene length (bp)1664
Transcript length (bp)1386
Coding sequence length (bp)1386
Protein length (aa) 462

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07808 RED_N RED-like protein N-terminal region 9.7E-17 49 159

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q66HG8|RED_RAT Protein Red OS=Rattus norvegicus GN=Ik PE=1 SV=1 57 129 1.0E-08
sp|Q13123|RED_HUMAN Protein Red OS=Homo sapiens GN=IK PE=1 SV=3 57 129 1.0E-08
sp|Q9Z1M8|RED_MOUSE Protein Red OS=Mus musculus GN=Ik PE=1 SV=2 57 129 1.0E-08
sp|Q5NVI3|RED_PONAB Protein Red OS=Pongo abelii GN=IK PE=2 SV=1 57 129 1.0E-08

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 25 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092070
MDQESFRLLLQSGSSPGAPVGSRANISSTSVKSKKVESSKPTFKPRKVKKVITADSKYRDRAAERRVGGGNDYAH
VEAIRDDFERQIAGNEDQTDVEEKRKYLGGDGEHSILVKGLDMALLEQNKARVAQEETVDDDTLEQVYLEASSSA
TVPKKRTRQDLIKELKQKRSRQDDPDSSATPESQTQASTIEKGDALEDAKKQGKFKPIGFKPIGALEEGKKKKKN
KNGGNVKEGGERKKKKRKVASPEAEVSKAKVPLPPSTEDPPPIPTNQSTAKVKEPEPEPLLEEDFDIFAGAGDYE
GLEVDDEEGEDETEPPAKSTSQEPAPAGSSRKWIEMEEEALSKPIPLPHEANDSKGLPSPNETQGRDPNRSDVEM
KGGAVPENEENEEQRTMRLEALESSNLPSIRDFLAMDDAALAAEKRKKRKEKKKSAGGPKSMEAKVNRDYQRLQS
YTSKKEGSGSR*
Coding >AgabiH97|092070
ATGGACCAGGAATCATTCAGACTTCTACTTCAATCAGGATCATCCCCGGGCGCCCCAGTTGGGTCCCGAGCAAAT
ATCTCTTCCACCTCGGTTAAATCGAAGAAAGTAGAAAGCTCAAAACCTACTTTCAAACCACGTAAAGTCAAGAAA
GTAATAACCGCCGACAGCAAGTATCGTGATCGAGCGGCCGAACGACGTGTAGGCGGAGGAAATGACTATGCTCAC
GTGGAAGCCATCCGAGACGACTTTGAACGTCAAATCGCTGGTAATGAAGACCAAACGGACGTTGAAGAGAAGCGC
AAATACTTGGGTGGAGATGGTGAACACTCTATTCTCGTCAAAGGTCTCGACATGGCACTTTTAGAGCAGAACAAA
GCTCGGGTCGCGCAGGAGGAAACTGTAGATGACGACACTCTCGAACAAGTCTATCTCGAGGCTTCTTCATCTGCT
ACCGTTCCCAAAAAGCGCACGCGGCAAGACCTCATCAAGGAACTCAAGCAAAAGCGATCTCGACAAGACGACCCT
GATTCCAGTGCTACTCCCGAGTCACAAACACAGGCATCCACAATTGAGAAAGGAGATGCGTTAGAAGACGCGAAG
AAGCAAGGAAAGTTCAAACCTATCGGCTTCAAGCCAATAGGTGCTCTAGAAGAGGGGAAGAAAAAAAAGAAGAAC
AAGAATGGTGGAAATGTTAAAGAGGGTGGAGAGAGGAAAAAGAAAAAGCGTAAAGTTGCAAGCCCTGAAGCTGAG
GTATCAAAGGCGAAAGTTCCATTGCCCCCCTCCACCGAAGACCCGCCACCTATCCCCACAAATCAATCAACTGCA
AAGGTTAAAGAGCCGGAACCAGAACCTCTGTTGGAAGAGGATTTCGATATTTTTGCTGGTGCCGGTGATTATGAA
GGTCTTGAGGTTGATGACGAAGAGGGCGAAGATGAAACAGAGCCTCCTGCTAAGTCAACATCTCAAGAGCCTGCA
CCGGCTGGTTCGTCAAGAAAATGGATTGAAATGGAAGAAGAAGCACTTTCTAAGCCGATTCCTTTGCCGCATGAA
GCGAATGACTCGAAGGGCTTACCTTCGCCGAACGAGACTCAGGGTAGAGATCCAAATAGGTCCGACGTTGAGATG
AAAGGTGGAGCAGTGCCAGAAAACGAGGAAAATGAAGAACAGCGAACAATGCGATTAGAAGCTTTAGAAAGCTCT
AATTTACCTTCAATACGAGATTTCCTAGCTATGGATGATGCCGCATTGGCAGCGGAGAAGCGGAAAAAGCGGAAA
GAGAAGAAGAAATCGGCTGGTGGTCCTAAAAGCATGGAAGCGAAAGTCAATCGCGATTATCAGCGGCTGCAATCG
TACACCAGCAAAAAAGAAGGCTCGGGGTCCCGGTAA
Transcript >AgabiH97|092070
ATGGACCAGGAATCATTCAGACTTCTACTTCAATCAGGATCATCCCCGGGCGCCCCAGTTGGGTCCCGAGCAAAT
ATCTCTTCCACCTCGGTTAAATCGAAGAAAGTAGAAAGCTCAAAACCTACTTTCAAACCACGTAAAGTCAAGAAA
GTAATAACCGCCGACAGCAAGTATCGTGATCGAGCGGCCGAACGACGTGTAGGCGGAGGAAATGACTATGCTCAC
GTGGAAGCCATCCGAGACGACTTTGAACGTCAAATCGCTGGTAATGAAGACCAAACGGACGTTGAAGAGAAGCGC
AAATACTTGGGTGGAGATGGTGAACACTCTATTCTCGTCAAAGGTCTCGACATGGCACTTTTAGAGCAGAACAAA
GCTCGGGTCGCGCAGGAGGAAACTGTAGATGACGACACTCTCGAACAAGTCTATCTCGAGGCTTCTTCATCTGCT
ACCGTTCCCAAAAAGCGCACGCGGCAAGACCTCATCAAGGAACTCAAGCAAAAGCGATCTCGACAAGACGACCCT
GATTCCAGTGCTACTCCCGAGTCACAAACACAGGCATCCACAATTGAGAAAGGAGATGCGTTAGAAGACGCGAAG
AAGCAAGGAAAGTTCAAACCTATCGGCTTCAAGCCAATAGGTGCTCTAGAAGAGGGGAAGAAAAAAAAGAAGAAC
AAGAATGGTGGAAATGTTAAAGAGGGTGGAGAGAGGAAAAAGAAAAAGCGTAAAGTTGCAAGCCCTGAAGCTGAG
GTATCAAAGGCGAAAGTTCCATTGCCCCCCTCCACCGAAGACCCGCCACCTATCCCCACAAATCAATCAACTGCA
AAGGTTAAAGAGCCGGAACCAGAACCTCTGTTGGAAGAGGATTTCGATATTTTTGCTGGTGCCGGTGATTATGAA
GGTCTTGAGGTTGATGACGAAGAGGGCGAAGATGAAACAGAGCCTCCTGCTAAGTCAACATCTCAAGAGCCTGCA
CCGGCTGGTTCGTCAAGAAAATGGATTGAAATGGAAGAAGAAGCACTTTCTAAGCCGATTCCTTTGCCGCATGAA
GCGAATGACTCGAAGGGCTTACCTTCGCCGAACGAGACTCAGGGTAGAGATCCAAATAGGTCCGACGTTGAGATG
AAAGGTGGAGCAGTGCCAGAAAACGAGGAAAATGAAGAACAGCGAACAATGCGATTAGAAGCTTTAGAAAGCTCT
AATTTACCTTCAATACGAGATTTCCTAGCTATGGATGATGCCGCATTGGCAGCGGAGAAGCGGAAAAAGCGGAAA
GAGAAGAAGAAATCGGCTGGTGGTCCTAAAAGCATGGAAGCGAAAGTCAATCGCGATTATCAGCGGCTGCAATCG
TACACCAGCAAAAAAGAAGGCTCGGGGTCCCGGTAA
Gene >AgabiH97|092070
ATGGACCAGGTATCTATCTATTCTTCAAACTCTACCCCCCAGTTATAAGTACTCAATGCCTCCCTTAGGAATCAT
TCAGACTTCTACTTCAATCAGGATCATCCCCGGGCGCCCCAGTTGGGTCCCGAGCAAATATCTCTTCCACCTCGG
TTAAATCGTGAGCTTTCTTTGCGTTCGTGCTATTCAACAGAATGAGCTCAACTGATACGCAAAGGAAGAAAGTAG
AAAGCTCAAAACCTACTTTCAAACCACGTAAAGTCAAGAAAGTAATAACCGCCGACAGCAAGTATCGTGATCGAG
CGGCCGAACGACGTGTAGGCGGAGGAAATGACTATGCTCACGTATGCACGGTCCAAAAATTCACATATGACTGTC
TAAAACTCCATATAGGTGGAAGCCATCCGAGACGACTTTGAACGTCAAATCGCTGGTAATGAAGACCAAACGGAC
GTGAGTTTAAGAAATTTGCTGTCCAGATGAATGGTCCTCAATACATGACTACTTTATATAGGTTGAAGAGAAGCG
CAAATACTTGGGTGGAGATGGTGAACACTCTATTCTCGTCAAAGGTCTCGACATGGCACTTTTAGAGCAGAACAA
AGCTCGGGTCGCGCAGGAGGAAACTGTAGATGACGACACTCTCGAACAAGTCTATCTCGAGGCTTCTTCATCTGC
TACCGTTCCCAAAAAGCGCACGCGGCAAGACCTCATCAAGGAACTCAAGCAAAAGCGATCTCGACAAGACGACCC
TGATTCCAGTGCTACTCCCGAGTCACAAACACAGGCATCCACAATTGAGAAAGGAGATGCGTTAGAAGACGCGAA
GAAGCAAGGAAAGTTCAAACCTATCGGCTTCAAGCCAATAGGTGCTCTAGAAGAGGGGAAGAAAAAAAAGAAGAA
CAAGAATGGTGGAAATGTTAAAGAGGGTGGAGAGAGGAAAAAGAAAAAGCGTAAAGTTGCAAGCCCTGAAGCTGA
GGTATCAAAGGCGAAAGTTCCATTGCCCCCCTCCACCGAAGACCCGCCACCTATCCCCACAAATCAATCAACTGC
AAAGGTTAAAGAGCCGGAACCAGAACCTCTGTTGGAAGAGGATTTCGATATTTTTGCTGGTGCCGGTGATTATGA
AGGTCTTGAGGTTGATGACGAAGAGGGCGAAGATGAAACAGAGCCTCCTGCTAAGTCAACATCTCAAGAGCCTGC
ACCGGCTGGTTCGTCAAGAAAATGGATTGAAATGGAAGAAGAAGCACTTTCTAAGCCGATTCCTTTGCCGCATGA
AGCGAATGACTCGAAGGGCTTACCTTCGCCGAACGAGACTCAGGGTAGAGATCCAAATAGGTCCGACGTTGAGAT
GAAAGGTGGAGCAGTGCCAGAAAACGAGGAAAATGAAGAACAGCGAACAATGCGATTAGAAGCTTTAGAAAGCTC
TAATTTACCTTCAATACGAGATTTCCTAGCTATGGATGATGCCGCATTGGCAGCGGAGAAGCGGAAAAAGCGGAA
AGAGAAGAAGAAATCGGCTGGTGGTCCTAAAAGCATGGAAGCGAAAGTCAATCGCGATTATCAGCGGTAAGTAAT
TATTATTGTTTGCTCCAGTTGCTTGCCTTGAACTATTCAATAGGCTGCAATCGTACACCAGCAAAAAAGAAGGCT
CGGGGTCCCGGTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail