Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|092040
Gene name
Locationscaffold_6:1000422..1002830
Strand-
Gene length (bp)2408
Transcript length (bp)1776
Coding sequence length (bp)1776
Protein length (aa) 592

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02733 Dak1 Dak1 domain 2.1E-104 21 329
PF02734 Dak2 DAK2 domain 5.8E-45 417 590

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13902|DAK1_SCHPO Dihydroxyacetone kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak1 PE=3 SV=1 6 587 2.0E-147
sp|O60017|DAK_PICAN Dihydroxyacetone kinase OS=Pichia angusta GN=DAK PE=3 SV=1 3 589 4.0E-136
sp|O74192|DAK_PICPA Dihydroxyacetone kinase OS=Komagataella pastoris GN=DAK PE=3 SV=1 3 589 2.0E-133
sp|O74215|DAK2_SCHPO Dihydroxyacetone kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak2 PE=3 SV=2 6 590 2.0E-132
sp|P54838|DAK1_YEAST Dihydroxyacetone kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK1 PE=1 SV=1 16 589 2.0E-132
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13902|DAK1_SCHPO Dihydroxyacetone kinase 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak1 PE=3 SV=1 6 587 2.0E-147
sp|O60017|DAK_PICAN Dihydroxyacetone kinase OS=Pichia angusta GN=DAK PE=3 SV=1 3 589 4.0E-136
sp|O74192|DAK_PICPA Dihydroxyacetone kinase OS=Komagataella pastoris GN=DAK PE=3 SV=1 3 589 2.0E-133
sp|O74215|DAK2_SCHPO Dihydroxyacetone kinase 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=dak2 PE=3 SV=2 6 590 2.0E-132
sp|P54838|DAK1_YEAST Dihydroxyacetone kinase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK1 PE=1 SV=1 16 589 2.0E-132
sp|P43550|DAK2_YEAST Dihydroxyacetone kinase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=DAK2 PE=3 SV=1 14 590 9.0E-129
sp|Q8VC30|TKFC_MOUSE Triokinase/FMN cyclase OS=Mus musculus GN=Tkfc PE=1 SV=1 3 590 8.0E-103
sp|Q3LXA3|TKFC_HUMAN Triokinase/FMN cyclase OS=Homo sapiens GN=TKFC PE=1 SV=2 3 578 8.0E-101
sp|Q4KLZ6|TKFC_RAT Triokinase/FMN cyclase OS=Rattus norvegicus GN=Tkfc PE=1 SV=1 3 590 1.0E-100
sp|Q58DK4|TKFC_BOVIN Triokinase/FMN cyclase OS=Bos taurus GN=TKFC PE=2 SV=1 3 578 1.0E-98
sp|O04059|DHBK_SOLLC Putative 3,4-dihydroxy-2-butanone kinase OS=Solanum lycopersicum GN=DHBK PE=2 SV=1 1 578 2.0E-92
sp|F1RKQ4|TKFC_PIG Triokinase/FMN cyclase OS=Sus scrofa GN=TKFC PE=1 SV=2 3 578 1.0E-91
sp|Q55EE0|DHAK_DICDI Probable dihydroxyacetone kinase OS=Dictyostelium discoideum GN=dhak PE=3 SV=1 44 591 1.0E-73
sp|P45510|DHAK_CITFR Dihydroxyacetone kinase OS=Citrobacter freundii GN=dhaK PE=1 SV=3 5 587 2.0E-66
sp|Q9CIV8|DHAK_LACLA PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dhaK PE=1 SV=2 3 327 2.0E-51
sp|P76015|DHAK_ECOLI PTS-dependent dihydroxyacetone kinase, dihydroxyacetone-binding subunit DhaK OS=Escherichia coli (strain K12) GN=dhaK PE=1 SV=2 6 356 3.0E-50
sp|Q9CIW0|DHAQ_LACLA DhaKLM operon coactivator DhaQ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dhaQ PE=1 SV=2 8 324 9.0E-42
sp|P45620|Y235_MYCCT Putative kinase MCAP_0235 OS=Mycoplasma capricolum subsp. capricolum (strain California kid / ATCC 27343 / NCTC 10154) GN=MCAP_0235 PE=3 SV=2 407 589 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0004371 glycerone kinase activity Yes
GO:0006071 glycerol metabolic process Yes
GO:0016740 transferase activity No
GO:0019400 alditol metabolic process No
GO:0016773 phosphotransferase activity, alcohol group as acceptor No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0016301 kinase activity No
GO:0016772 transferase activity, transferring phosphorus-containing groups No
GO:0044281 small molecule metabolic process No
GO:0008152 metabolic process No
GO:0006066 alcohol metabolic process No
GO:1901615 organic hydroxy compound metabolic process No
GO:0005975 carbohydrate metabolic process No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0044262 cellular carbohydrate metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0019751 polyol metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|092040
MSIQSKHFLNTSESLVVDSLKGLCALNPQLALDVENKTVFVAKQDRSKVALMCGGGSGHEPAHAGFVGEGMLTSA
VCGNVFASPSAGQVRRGIDLIDNEKGTVIIVKNYTGDVLNFGLAKEQYAAMHSEKANRVKFVIVGDDVAVGRTQG
KIVGRRGLAGTVLVYKIAGALAHRGGSLDEVYKIAEWTSQNIATVGTSLGHVHVPGTAPLETNLGQSEIEIGMGI
HNESGHQTVSPIPPLSQLILRLIDMTISTSDPDRSFIPFKGQDEVVLLVNNLGGLSELELGAIVGQTRDALDVRG
LKALRVLSGSFMSSLNMPGFSITLLLLPREGDASAPSAQHILSLLDDKPDVPGWKWSSAQPPAAKASQIIQSTAT
AQQSKPRILKAVDPDAFVKKIRQAANALIKAEPDITRMDLIAGDGDCGLTLKAGAEAILKKIDENAINGNDVAGS
VMTISQVSEEIMGGTSGALYSIFFSGLSQGLQTTSSDVVDARVWAQALKTALDNLYTYTRARPPSRTLVDPLEAF
ITAISASGGERLADAVRAADKAAEATKDLEAKAGRSAYVEGDKLKQEQVPDPGAWGVKVILENILA*
Coding >AgabiH97|092040
ATGTCCATCCAAAGCAAGCATTTTCTGAACACCTCGGAATCTCTGGTCGTCGACTCGCTCAAAGGTCTCTGTGCC
CTCAATCCACAGCTCGCCCTCGATGTTGAGAACAAGACCGTATTTGTCGCCAAACAAGATCGTTCAAAGGTCGCC
CTGATGTGTGGCGGAGGCTCCGGTCACGAGCCCGCTCATGCCGGCTTCGTAGGCGAAGGCATGCTGACGAGTGCT
GTTTGTGGTAATGTTTTTGCCTCTCCCAGCGCAGGTCAAGTCCGTCGCGGCATAGACTTGATTGACAATGAGAAA
GGAACCGTCATCATAGTCAAGAACTATACGGGTGATGTTCTTAATTTCGGTTTGGCCAAAGAACAATATGCGGCT
ATGCACTCGGAGAAGGCAAACCGTGTCAAATTTGTCATTGTCGGTGACGATGTTGCCGTTGGTAGGACTCAGGGC
AAGATCGTCGGTCGTAGAGGGCTCGCCGGAACCGTCTTGGTATACAAAATTGCTGGAGCCTTGGCTCACCGTGGC
GGCTCGCTCGATGAAGTTTATAAAATTGCAGAATGGACATCTCAGAACATCGCCACCGTTGGTACCAGTCTTGGT
CATGTCCATGTTCCTGGAACTGCTCCTCTCGAAACAAATCTGGGACAGTCTGAAATTGAAATTGGCATGGGCATA
CACAACGAAAGCGGTCATCAAACCGTCTCGCCCATCCCACCGTTGTCGCAACTGATTCTAAGGTTGATTGACATG
ACGATATCGACTTCTGACCCGGACCGTTCCTTTATACCATTCAAAGGACAAGACGAGGTTGTGTTACTAGTGAAC
AATCTCGGTGGCCTGAGCGAGCTCGAACTCGGAGCCATCGTTGGACAAACCAGAGATGCTCTCGATGTTCGTGGC
CTCAAGGCGTTGCGCGTGTTGTCTGGCAGCTTTATGAGCAGCTTGAACATGCCGGGATTTTCTATTACACTTCTT
TTGTTACCACGCGAAGGCGATGCTTCAGCCCCTTCTGCTCAGCACATCTTGTCTCTTTTAGACGATAAGCCTGAT
GTTCCTGGTTGGAAATGGTCCTCCGCGCAACCTCCTGCTGCCAAAGCTTCTCAGATCATTCAGAGTACCGCGACA
GCGCAGCAAAGTAAACCAAGAATCCTAAAGGCTGTTGATCCTGATGCTTTCGTAAAGAAAATCCGACAGGCAGCC
AACGCGCTAATCAAGGCTGAACCGGATATCACTCGAATGGATTTGATTGCCGGGGACGGTGACTGTGGACTCACT
CTCAAGGCGGGTGCGGAAGCTATACTCAAGAAGATCGACGAAAACGCCATCAATGGCAACGATGTAGCAGGATCG
GTCATGACAATATCTCAAGTGTCAGAAGAAATCATGGGTGGTACTAGTGGTGCTCTTTACTCCATATTCTTCTCC
GGGCTTTCTCAAGGCTTGCAAACTACGTCAAGTGACGTCGTTGATGCGCGTGTTTGGGCTCAAGCATTGAAGACG
GCTTTGGACAATCTTTACACCTACACTCGAGCTCGCCCACCTTCTCGTACTCTTGTTGATCCTTTGGAAGCTTTC
ATTACTGCGATTTCTGCTAGCGGTGGTGAACGTCTGGCTGATGCGGTTCGTGCAGCGGACAAGGCTGCAGAGGCG
ACAAAGGATCTGGAAGCCAAAGCTGGGCGGAGCGCGTACGTTGAAGGTGATAAACTCAAGCAGGAGCAAGTCCCT
GATCCAGGTGCATGGGGAGTCAAAGTCATTTTGGAGAATATTCTTGCGTGA
Transcript >AgabiH97|092040
ATGTCCATCCAAAGCAAGCATTTTCTGAACACCTCGGAATCTCTGGTCGTCGACTCGCTCAAAGGTCTCTGTGCC
CTCAATCCACAGCTCGCCCTCGATGTTGAGAACAAGACCGTATTTGTCGCCAAACAAGATCGTTCAAAGGTCGCC
CTGATGTGTGGCGGAGGCTCCGGTCACGAGCCCGCTCATGCCGGCTTCGTAGGCGAAGGCATGCTGACGAGTGCT
GTTTGTGGTAATGTTTTTGCCTCTCCCAGCGCAGGTCAAGTCCGTCGCGGCATAGACTTGATTGACAATGAGAAA
GGAACCGTCATCATAGTCAAGAACTATACGGGTGATGTTCTTAATTTCGGTTTGGCCAAAGAACAATATGCGGCT
ATGCACTCGGAGAAGGCAAACCGTGTCAAATTTGTCATTGTCGGTGACGATGTTGCCGTTGGTAGGACTCAGGGC
AAGATCGTCGGTCGTAGAGGGCTCGCCGGAACCGTCTTGGTATACAAAATTGCTGGAGCCTTGGCTCACCGTGGC
GGCTCGCTCGATGAAGTTTATAAAATTGCAGAATGGACATCTCAGAACATCGCCACCGTTGGTACCAGTCTTGGT
CATGTCCATGTTCCTGGAACTGCTCCTCTCGAAACAAATCTGGGACAGTCTGAAATTGAAATTGGCATGGGCATA
CACAACGAAAGCGGTCATCAAACCGTCTCGCCCATCCCACCGTTGTCGCAACTGATTCTAAGGTTGATTGACATG
ACGATATCGACTTCTGACCCGGACCGTTCCTTTATACCATTCAAAGGACAAGACGAGGTTGTGTTACTAGTGAAC
AATCTCGGTGGCCTGAGCGAGCTCGAACTCGGAGCCATCGTTGGACAAACCAGAGATGCTCTCGATGTTCGTGGC
CTCAAGGCGTTGCGCGTGTTGTCTGGCAGCTTTATGAGCAGCTTGAACATGCCGGGATTTTCTATTACACTTCTT
TTGTTACCACGCGAAGGCGATGCTTCAGCCCCTTCTGCTCAGCACATCTTGTCTCTTTTAGACGATAAGCCTGAT
GTTCCTGGTTGGAAATGGTCCTCCGCGCAACCTCCTGCTGCCAAAGCTTCTCAGATCATTCAGAGTACCGCGACA
GCGCAGCAAAGTAAACCAAGAATCCTAAAGGCTGTTGATCCTGATGCTTTCGTAAAGAAAATCCGACAGGCAGCC
AACGCGCTAATCAAGGCTGAACCGGATATCACTCGAATGGATTTGATTGCCGGGGACGGTGACTGTGGACTCACT
CTCAAGGCGGGTGCGGAAGCTATACTCAAGAAGATCGACGAAAACGCCATCAATGGCAACGATGTAGCAGGATCG
GTCATGACAATATCTCAAGTGTCAGAAGAAATCATGGGTGGTACTAGTGGTGCTCTTTACTCCATATTCTTCTCC
GGGCTTTCTCAAGGCTTGCAAACTACGTCAAGTGACGTCGTTGATGCGCGTGTTTGGGCTCAAGCATTGAAGACG
GCTTTGGACAATCTTTACACCTACACTCGAGCTCGCCCACCTTCTCGTACTCTTGTTGATCCTTTGGAAGCTTTC
ATTACTGCGATTTCTGCTAGCGGTGGTGAACGTCTGGCTGATGCGGTTCGTGCAGCGGACAAGGCTGCAGAGGCG
ACAAAGGATCTGGAAGCCAAAGCTGGGCGGAGCGCGTACGTTGAAGGTGATAAACTCAAGCAGGAGCAAGTCCCT
GATCCAGGTGCATGGGGAGTCAAAGTCATTTTGGAGAATATTCTTGCGTGA
Gene >AgabiH97|092040
ATGTCCATCCAAAGTACGCACATCCTCTCTCCTGTTTCTCTTGCTTGACCCGCCCTCTAGGCAAGCATTTTCTGA
ACACCTCGGAATCTCTGGTCGTCGACTCGCTCAAAGGTCTCTGTGCCCTCAATCCACAGCTCGCCCTCGATGTTG
AGAACAAGAGTGCGTGAGAACACCCTCCACATCTTTCATCGATATCAAATCGTTCCTCCTCTAGCCGTATTTGTC
GCCAAACAAGATCGTTCAAAGGTCGCCCTGATGTGTGGCGGAGGCTCCGGTCACGAGCCCGCTCATGCCGGCTTC
GTAGGTACACAACTCGTTCATCTTCATCGACAAATCACCATCTAATCATGACTACTCCTATCTAGGCGAAGGCAT
GCTGACGAGTGCGTTACCTTGTGTCCGCAAAAGCGATCTATCCCTCAGTCGTACTGTACATTAAGGTGCTGTTTG
TGGTAATGTTTTTGCCTCTCCCAGCGCAGGTCAAGTCCGTCGCGGCATAGACTTGATTGACAATGAGAAAGGGTA
CGTAATGTATCCGTAGCCAGTGCAAAGTAACTCACTTGGTGATAGAACCGTCATCATAGTCAAGTAAGCTGCCAC
TATAGTCTGACAATTCGCCTTTGCCTAACATTCATAGGAACTATACGGGTGATGTTCTTAATTTCGGTTTGGCCA
AAGAACAATATGCGGCTATGCACTCGGAGAAGGCAAACCGTGTCAAATTTGTCATTGTCGGTGACGATGTTGCCG
TTGGTAGGACTCAGGGCAAGATCGTCGGTCGTAGGTACATGTGCACTCAACTTGCTTCGCTCTCCCCAGCCCACA
ATTATATACAGAGGGCTCGCCGGAACCGTCTTGGTATACAAAATTGCTGGAGCCTTGGCTCACCGTGGCGGCTCG
CTCGATGAAGTTTATAAAATTGCAGAATGGACATCTCAGAACATCGCCACCGTTGGTACCAGTCTTGGTCATGTC
CATGTAGGACCGTTTCGTTTGCTTCTTGTTTGATCTTCTACCTTACATCTGCTGGCCCATACCAGGTTCCTGGAA
CTGCTCCTCTCGAAACAAATCTGGGACAGTCTGAAATTGAAATTGGCATGGGCATACACAACGAAAGCGGTCATC
AAACCGTCTCGCCCATCCCACCGTTGTCGCAACTGATTCTAAGGTTGATTGACATGACGATATCGACTTCTGACC
CGGACCGTTCCTTTATACCATTCAAAGGACAAGACGAGGTTGTGTTACTAGTGAACAATCTCGGTGGCCTGAGCG
AGCTCGAACTCGGAGCCATCGTTGGACAAACCAGAGATGCTCTCGATGTTCGTGGCCTCAAGGCGTTGCGCGTGT
TGTCTGGCAGCTTTATGGTGAGGAATTTACTAATCAATGTCGCTTCTACTAATAAACTCACAGAGCAGCTTGAAC
ATGCCGGGATTTTCTATTACACTTCTTTTGTTACCACGCGAAGGCGATGCTTCAGCCCCTTCTGCTCAGCACATC
TTGTCTCTTTTAGACGATAAGCCTGATGTTCCTGGTTGGAAATGGTCCTCCGCGCAACCTCCTGCTGCCAAAGCT
TCTCAGATCATTCAGAGTACCGCGACAGCGCAGCAAAGTAAACCAAGAATCCTAAAGGCTGTTGATCCTGATGCT
TTCGTAAAGAAAATCCGACAGGCAGCCAACGCGCTAATCAAGGCTGAACCGGATATCACTCGAATGGATTTGATT
GCCGGGGACGGTGACTGTGGACTCACTCTCAAGGTATGAAAAAAAATGCAACTATATAATTCTTAATCTGACCCA
TCATCGTCCAGGCGGGTGCGGAAGGTATGCTTTTGGCCATTGATTTTCTCGTTCAGCAGTAACGAGGTTGTATAG
CTATACTCAAGAAGATCGACGAAAACGCCATCAATGGCAACGATGTAGCAGGATCGGTCATGACAATATCTCAAG
TGTCAGAAGAAATCATGGGTGGTACTAGTGGTGCTCTTTACTCGTATGTCCCATGATCTGATTCATCTCACAATT
CATGACGATTCCCGAACAGCATATTCTTCTCCGGGCTTTCTCAAGGCTTGCAAACTACGTCAAGTGACGTCGTTG
ATGCGCGTGTTTGGGCTCAAGCATTGAAGACGGCTTTGGACAATCTTTACACCTACACTCGAGCTCGCCCACCTT
CTCGTACTCTTGTTGATCCTTTGGAAGCTTTCATTACTGCGATTTCTGCTAGCGGTGGTGAACGTCTGGCTGATG
CGGTTCGTGCAGCGGACAAGGCTGCAGAGGCGACAAAGGATCTGGAAGCCAAAGCTGGGCGGAGCGCGTACGTTG
AAGGTGATAAACTCAAGCAGGAGCAAGTCCCTGATCCAGGTGCATGGGGAGTCAAAGTCATTTTGGAGAATATTC
TTGCGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail