Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091940
Gene name
Locationscaffold_6:979394..980818
Strand-
Gene length (bp)1424
Transcript length (bp)1188
Coding sequence length (bp)1188
Protein length (aa) 396

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00722 Glyco_hydro_16 Glycosyl hydrolases family 16 2.5E-05 133 225

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 89 385 6.0E-73
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 89 385 4.0E-66
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 89 385 5.0E-65
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 86 385 7.0E-65
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 63 385 1.0E-64
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9USW3|YHZ7_SCHPO Probable glycosidase C21B10.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21B10.07 PE=3 SV=1 89 385 6.0E-73
sp|Q2UIE6|EGLX_ASPOR Probable endo-1,3(4)-beta-glucanase AO090023000083 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=AO090023000083 PE=3 SV=1 89 385 4.0E-66
sp|A1C7B5|EGLX_ASPCL Probable endo-1,3(4)-beta-glucanase ACLA_073210 OS=Aspergillus clavatus (strain ATCC 1007 / CBS 513.65 / DSM 816 / NCTC 3887 / NRRL 1) GN=ACLA_073210 PE=3 SV=1 89 385 5.0E-65
sp|D4AJR9|EGLX_ARTBC Endo-1,3(4)-beta-glucanase ARB_04519 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04519 PE=3 SV=1 86 385 7.0E-65
sp|Q4X084|EGLX_ASPFU Probable endo-1,3(4)-beta-glucanase AFUA_2G14360 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=AFUA_2G14360 PE=3 SV=1 63 385 1.0E-64
sp|B0XTU6|EGLX_ASPFC Probable endo-1,3(4)-beta-glucanase AFUB_029980 OS=Neosartorya fumigata (strain CEA10 / CBS 144.89 / FGSC A1163) GN=AFUB_029980 PE=3 SV=1 63 385 1.0E-64
sp|A1DHY9|EGLX_NEOFI Probable endo-1,3(4)-beta-glucanase NFIA_089530 OS=Neosartorya fischeri (strain ATCC 1020 / DSM 3700 / FGSC A1164 / NRRL 181) GN=NFIA_089530 PE=3 SV=1 67 385 9.0E-64
sp|A2QBQ3|EGLX_ASPNC Probable endo-1,3(4)-beta-glucanase An02g00850 OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=An02g00850 PE=3 SV=1 85 385 3.0E-63
sp|B8N7S7|EGLX_ASPFN Probable endo-1,3(4)-beta-glucanase AFLA_105200 OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=AFLA_105200 PE=3 SV=1 89 385 1.0E-62
sp|Q5BAP5|EGLX_EMENI Endo-1,3(4)-beta-glucanase xgeA OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=xgeA PE=3 SV=1 85 385 2.0E-61
[Show less]

GO

GO Term Description Terminal node
GO:0004553 hydrolase activity, hydrolyzing O-glycosyl compounds Yes
GO:0005975 carbohydrate metabolic process Yes
GO:0016798 hydrolase activity, acting on glycosyl bonds No
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 18 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 26.41 13.97 38.84
Initials Initials knots 10.01 4.84 15.19
Pileal_Stipeal_center Stage I stipe center 7.70 3.54 11.86
Pileal_Stipeal_shell Stage I stipe shell 11.87 5.85 17.88
DIF_stipe_center Stage II stipe center 9.33 4.46 14.19
DIF_stipe_shell Stage II stipe shell 6.15 2.75 9.56
DIF_stipe_skin Stage II stipe skin 7.52 3.46 11.58
DIF_cap_skin Stage II cap skin 10.81 5.29 16.33
DIF_cap_tissue Stage II cap tissue 9.26 4.43 14.09
DIF_gill_tissue Stage II gill tissue 9.37 4.47 14.27
YFB_stipe_center Young fruiting body stipe center 9.47 4.55 14.39
YFB_stipe_shell Young fruiting body stipe shell 9.70 4.67 14.73
YFB_stipe_skin Young fruiting body stipe skin 7.80 3.57 12.03
YFB_cap_skin Young fruiting body cap skin 10.09 4.86 15.32
YFB_cap_tissue Young fruiting body cap tissue 6.90 3.14 10.65
YFB_gill_tissue Young fruiting body gill tissue 8.95 4.26 13.64
YFB_veil Young fruiting body veil 10.92 5.29 16.55

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.001140 yes
Casing YFB_stipe_center 0.001625 yes
Casing YFB_stipe_shell 0.001625 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.002525 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.004160 yes
Casing Initials 0.001140 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.009446 yes
Casing DIF_stipe_center 0.001625 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.001625 yes
Casing DIF_cap_skin 0.002084 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.988465 no
DIF_gill_tissue YFB_stipe_shell 0.961833 no
DIF_gill_tissue YFB_stipe_skin 0.745713 no
DIF_gill_tissue YFB_cap_skin 0.912722 no
DIF_gill_tissue YFB_cap_tissue 0.518261 no
DIF_gill_tissue YFB_gill_tissue 0.948073 no
DIF_gill_tissue YFB_veil 0.794116 no
YFB_stipe_center YFB_stipe_shell 0.974032 no
YFB_stipe_center YFB_stipe_skin 0.724478 no
YFB_stipe_center YFB_cap_skin 0.926220 no
YFB_stipe_center YFB_cap_tissue 0.499171 no
YFB_stipe_center YFB_gill_tissue 0.935636 no
YFB_stipe_center YFB_veil 0.810684 no
YFB_stipe_shell YFB_stipe_skin 0.680979 no
YFB_stipe_shell YFB_cap_skin 0.955744 no
YFB_stipe_shell YFB_cap_tissue 0.452554 no
YFB_stipe_shell YFB_gill_tissue 0.903115 no
YFB_stipe_shell YFB_veil 0.848355 no
YFB_stipe_skin YFB_cap_skin 0.599229 no
YFB_stipe_skin YFB_cap_tissue 0.846240 no
YFB_stipe_skin YFB_gill_tissue 0.821737 no
YFB_stipe_skin YFB_veil 0.450181 no
YFB_cap_skin YFB_cap_tissue 0.387445 no
YFB_cap_skin YFB_gill_tissue 0.847249 no
YFB_cap_skin YFB_veil 0.907485 no
YFB_cap_tissue YFB_gill_tissue 0.610121 no
YFB_cap_tissue YFB_veil 0.257979 no
YFB_gill_tissue YFB_veil 0.710589 no
Initials DIF_gill_tissue 0.925614 no
Initials YFB_stipe_center 0.936445 no
Initials YFB_stipe_shell 0.965435 no
Initials YFB_stipe_skin 0.621622 no
Initials YFB_cap_skin 0.990887 no
Initials YFB_cap_tissue 0.396816 no
Initials YFB_gill_tissue 0.860213 no
Initials YFB_veil 0.897193 no
Initials Pileal_Stipeal_center 0.596399 no
Initials Pileal_Stipeal_shell 0.754191 no
Initials DIF_stipe_center 0.917413 no
Initials DIF_stipe_shell 0.224926 no
Initials DIF_stipe_skin 0.556082 no
Initials DIF_cap_skin 0.908551 no
Initials DIF_cap_tissue 0.910025 no
Pileal_Stipeal_center DIF_gill_tissue 0.721862 no
Pileal_Stipeal_center YFB_stipe_center 0.702761 no
Pileal_Stipeal_center YFB_stipe_shell 0.658176 no
Pileal_Stipeal_center YFB_stipe_skin 0.985728 no
Pileal_Stipeal_center YFB_cap_skin 0.581604 no
Pileal_Stipeal_center YFB_cap_tissue 0.865299 no
Pileal_Stipeal_center YFB_gill_tissue 0.801537 no
Pileal_Stipeal_center YFB_veil 0.442260 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.284348 no
Pileal_Stipeal_center DIF_stipe_center 0.728193 no
Pileal_Stipeal_center DIF_stipe_shell 0.680674 no
Pileal_Stipeal_center DIF_stipe_skin 0.974692 no
Pileal_Stipeal_center DIF_cap_skin 0.443716 no
Pileal_Stipeal_center DIF_cap_tissue 0.743888 no
Pileal_Stipeal_shell DIF_gill_tissue 0.624900 no
Pileal_Stipeal_shell YFB_stipe_center 0.648203 no
Pileal_Stipeal_shell YFB_stipe_shell 0.695943 no
Pileal_Stipeal_shell YFB_stipe_skin 0.295235 no
Pileal_Stipeal_shell YFB_cap_skin 0.766629 no
Pileal_Stipeal_shell YFB_cap_tissue 0.145655 no
Pileal_Stipeal_shell YFB_gill_tissue 0.534315 no
Pileal_Stipeal_shell YFB_veil 0.895747 no
Pileal_Stipeal_shell DIF_stipe_center 0.615658 no
Pileal_Stipeal_shell DIF_stipe_shell 0.068081 no
Pileal_Stipeal_shell DIF_stipe_skin 0.246090 no
Pileal_Stipeal_shell DIF_cap_skin 0.877194 no
Pileal_Stipeal_shell DIF_cap_tissue 0.601750 no
DIF_stipe_center DIF_gill_tissue 0.994280 no
DIF_stipe_center YFB_stipe_center 0.983643 no
DIF_stipe_center YFB_stipe_shell 0.956892 no
DIF_stipe_center YFB_stipe_skin 0.751241 no
DIF_stipe_center YFB_cap_skin 0.906368 no
DIF_stipe_center YFB_cap_tissue 0.522819 no
DIF_stipe_center YFB_gill_tissue 0.953468 no
DIF_stipe_center YFB_veil 0.783866 no
DIF_stipe_center DIF_stipe_shell 0.323160 no
DIF_stipe_center DIF_stipe_skin 0.689910 no
DIF_stipe_center DIF_cap_skin 0.793055 no
DIF_stipe_center DIF_cap_tissue 0.991509 no
DIF_stipe_shell DIF_gill_tissue 0.318702 no
DIF_stipe_shell YFB_stipe_center 0.303463 no
DIF_stipe_shell YFB_stipe_shell 0.269676 no
DIF_stipe_shell YFB_stipe_skin 0.652449 no
DIF_stipe_shell YFB_cap_skin 0.209362 no
DIF_stipe_shell YFB_cap_tissue 0.859917 no
DIF_stipe_shell YFB_gill_tissue 0.390876 no
DIF_stipe_shell YFB_veil 0.130110 no
DIF_stipe_shell DIF_stipe_skin 0.722094 no
DIF_stipe_shell DIF_cap_skin 0.125429 no
DIF_stipe_shell DIF_cap_tissue 0.332804 no
DIF_stipe_skin DIF_gill_tissue 0.677830 no
DIF_stipe_skin YFB_stipe_center 0.660782 no
DIF_stipe_skin YFB_stipe_shell 0.614092 no
DIF_stipe_skin YFB_stipe_skin 0.960086 no
DIF_stipe_skin YFB_cap_skin 0.534840 no
DIF_stipe_skin YFB_cap_tissue 0.899599 no
DIF_stipe_skin YFB_gill_tissue 0.759503 no
DIF_stipe_skin YFB_veil 0.395814 no
DIF_stipe_skin DIF_cap_skin 0.395511 no
DIF_stipe_skin DIF_cap_tissue 0.698899 no
DIF_cap_skin DIF_gill_tissue 0.804326 no
DIF_cap_skin YFB_stipe_center 0.819762 no
DIF_cap_skin YFB_stipe_shell 0.859476 no
DIF_cap_skin YFB_stipe_skin 0.456598 no
DIF_cap_skin YFB_cap_skin 0.915831 no
DIF_cap_skin YFB_cap_tissue 0.256120 no
DIF_cap_skin YFB_gill_tissue 0.716767 no
DIF_cap_skin YFB_veil 0.988157 no
DIF_cap_skin DIF_cap_tissue 0.781550 no
DIF_cap_tissue DIF_gill_tissue 0.986745 no
DIF_cap_tissue YFB_stipe_center 0.977194 no
DIF_cap_tissue YFB_stipe_shell 0.949084 no
DIF_cap_tissue YFB_stipe_skin 0.765922 no
DIF_cap_tissue YFB_cap_skin 0.895995 no
DIF_cap_tissue YFB_cap_tissue 0.535600 no
DIF_cap_tissue YFB_gill_tissue 0.962154 no
DIF_cap_tissue YFB_veil 0.773355 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091940
MLCRSFFLLFLAAGTLARGHFGRQSTHPKLGRHRHHALNRLPSQDTEDVDDPGHGDNGTWTNTTSMIGASKDDTS
ASNTSTSSGASGPYKLDVRYTGQDFFNEWDFFTAADPTHGKVNYLSKEDAKSKKLAYTNNGATFLAVDDKTTLQP
GQNRDSVRITSKKTWSSGLFIADFAQVPYGCSVWPAYWSVGPAWPTGGEIDVFEGVNNQATNQYTLHTSKGCTSS
QGSIKPTGKVSNKQCATINGDNTGCGFIDPNESSYGAGFNAAGGGVFAHLWDQSGIKIWHFARNEIPQDIQAISD
YGAATTGSPNPDSWGTPVAFWSPDTCDMGSHFHDHSLVFDTTLCGDWAGATYSSSGCPGTCEQAVADPSNFKNAK
WKINYVSVYQPVGLDYNSSY*
Coding >AgabiH97|091940
ATGCTGTGTCGATCTTTCTTTCTCCTCTTCCTGGCGGCTGGTACATTGGCTAGAGGTCATTTTGGAAGACAATCA
ACTCACCCTAAACTGGGTCGTCATCGTCACCACGCTCTAAACCGTCTTCCATCTCAGGACACTGAAGATGTCGAT
GATCCAGGACATGGTGATAACGGCACTTGGACTAATACCACCTCGATGATTGGTGCTTCAAAGGATGATACCTCA
GCAAGTAACACTTCAACGTCGTCAGGCGCTTCTGGGCCTTATAAGCTGGATGTTCGCTATACAGGACAAGACTTT
TTCAATGAATGGGATTTCTTTACTGCCGCAGACCCTACGCACGGAAAGGTCAATTATCTCAGCAAAGAAGATGCC
AAATCGAAGAAATTGGCATATACTAATAATGGTGCTACCTTTCTGGCTGTCGACGACAAGACCACTTTACAGCCT
GGGCAAAACCGTGATTCCGTCCGGATAACTAGTAAAAAGACGTGGAGTAGTGGCCTGTTCATCGCAGACTTTGCG
CAAGTTCCTTATGGATGTAGTGTTTGGCCGGCATACTGGTCCGTTGGCCCAGCGTGGCCTACAGGTGGTGAAATC
GATGTCTTTGAGGGTGTAAACAACCAAGCCACCAACCAGTACACTCTCCATACCTCCAAAGGGTGTACCTCCTCC
CAAGGTTCAATCAAACCCACGGGTAAAGTTTCCAATAAACAATGCGCGACCATCAACGGCGATAACACCGGTTGC
GGTTTCATTGACCCTAATGAATCCTCGTACGGTGCAGGCTTCAACGCCGCTGGTGGTGGAGTTTTCGCTCACCTA
TGGGATCAATCTGGTATCAAGATATGGCATTTTGCTAGGAATGAAATTCCGCAAGATATCCAAGCTATTTCTGAT
TATGGTGCTGCTACTACTGGAAGCCCTAACCCGGATTCTTGGGGTACACCGGTTGCGTTCTGGAGTCCGGATACG
TGCGATATGGGCAGCCATTTCCATGATCATTCTTTGGTTTTTGATACGACATTATGTGGTGACTGGGCTGGTGCT
ACATATAGTAGCTCGGGTTGTCCTGGTACCTGCGAACAAGCAGTGGCTGATCCGTCCAATTTCAAGAATGCCAAA
TGGAAGATTAATTATGTTTCTGTTTATCAGCCAGTCGGATTAGATTACAATTCATCTTATTAA
Transcript >AgabiH97|091940
ATGCTGTGTCGATCTTTCTTTCTCCTCTTCCTGGCGGCTGGTACATTGGCTAGAGGTCATTTTGGAAGACAATCA
ACTCACCCTAAACTGGGTCGTCATCGTCACCACGCTCTAAACCGTCTTCCATCTCAGGACACTGAAGATGTCGAT
GATCCAGGACATGGTGATAACGGCACTTGGACTAATACCACCTCGATGATTGGTGCTTCAAAGGATGATACCTCA
GCAAGTAACACTTCAACGTCGTCAGGCGCTTCTGGGCCTTATAAGCTGGATGTTCGCTATACAGGACAAGACTTT
TTCAATGAATGGGATTTCTTTACTGCCGCAGACCCTACGCACGGAAAGGTCAATTATCTCAGCAAAGAAGATGCC
AAATCGAAGAAATTGGCATATACTAATAATGGTGCTACCTTTCTGGCTGTCGACGACAAGACCACTTTACAGCCT
GGGCAAAACCGTGATTCCGTCCGGATAACTAGTAAAAAGACGTGGAGTAGTGGCCTGTTCATCGCAGACTTTGCG
CAAGTTCCTTATGGATGTAGTGTTTGGCCGGCATACTGGTCCGTTGGCCCAGCGTGGCCTACAGGTGGTGAAATC
GATGTCTTTGAGGGTGTAAACAACCAAGCCACCAACCAGTACACTCTCCATACCTCCAAAGGGTGTACCTCCTCC
CAAGGTTCAATCAAACCCACGGGTAAAGTTTCCAATAAACAATGCGCGACCATCAACGGCGATAACACCGGTTGC
GGTTTCATTGACCCTAATGAATCCTCGTACGGTGCAGGCTTCAACGCCGCTGGTGGTGGAGTTTTCGCTCACCTA
TGGGATCAATCTGGTATCAAGATATGGCATTTTGCTAGGAATGAAATTCCGCAAGATATCCAAGCTATTTCTGAT
TATGGTGCTGCTACTACTGGAAGCCCTAACCCGGATTCTTGGGGTACACCGGTTGCGTTCTGGAGTCCGGATACG
TGCGATATGGGCAGCCATTTCCATGATCATTCTTTGGTTTTTGATACGACATTATGTGGTGACTGGGCTGGTGCT
ACATATAGTAGCTCGGGTTGTCCTGGTACCTGCGAACAAGCAGTGGCTGATCCGTCCAATTTCAAGAATGCCAAA
TGGAAGATTAATTATGTTTCTGTTTATCAGCCAGTCGGATTAGATTACAATTCATCTTATTAA
Gene >AgabiH97|091940
ATGCTGTGTCGATCTTTCTTTCTCCTCTTCCTGGCGGCTGGTACATTGGCTAGAGGTCATTTTGGAAGACAATCA
ACTCACCCTAAACTGGGTCGTCATCGTCACCACGCTCTAAACCGTCTTCCATCTCAGGACACTGAAGATGTCGAT
GATCCAGGACATGGTGATAACGGCACTTGGACTAATACCACCTCGATGATTGGTGCTTCAAAGGATGATACCTCA
GCAAGTAACACTTCAACGTCGTCAGGCGCTTCTGGGCCTTATAAGCTGGATGTTCGCTATACAGGACAAGACTTT
TTCAAGTAAGCTCCCCTTATACAAAAAGATTATCTTTAACTTACCGACGTCTCTTTAGTGAATGGGATTTCTTTA
CTGCCGCAGACCCTACGCACGGAAAGGTCAATTATCTCAGCAAAGAAGATGCCAAATCGAAGAAATTGGCATATA
CTAATAATGGTGCTACCTTTCTGGCTGTCGACGACAAGACCACTTTACAGCCTGGGCAAAACCGTGATTCGTACG
TTATTTCTTGAACGCCCAAGCTTCACTTATTTTATTGTTGACAACTCTCCGTCCCCTCTTTTTAGCGTCCGGATA
ACTAGTAAAAAGACGTGGAGTAGTGGCCTGTTCATCGCAGACTTTGCGCAAGTTCCTTATGGATGTAGTGTTTGG
CCGGCATACTGGTCCGTTGGCCCAGCGTGGCCTACAGGTGGTGTGTTCTATTTCACTCATTATCAGATACCGTTT
CCTCACACATTCCGATTATCAAGGTGAAATCGATGTCTTTGAGGGTGTAAACAACCAAGCCACCAACCAGTACAC
TCTCCATACCTCCAAAGGGTGTACCTCCTCCCAAGGTTCAATCAAACCCACGGGTAAAGTTTCCAATAAACAATG
CGCGACCATCAACGGCGATAACACCGGTTGCGGTTTCATTGACCCTAATGAATCCTCGTACGGTGCAGGCTTCAA
CGCCGCTGGTGGTGGAGTTTTCGCTCACCTATGGGATCAATCTGGTATCAAGATATGGCATTTTGCTAGGAATGA
AATTCCGCAAGATATCCAAGCTATTTCTGATTATGGTGCTGCTACTACTGGAAGCCCTAACCCGGATTCTTGGGG
TACACCGGTTGCGTTCTGGAGTCCGGATACGTGCGATATGGGCAGCCATTTCCATGATCATTCTTTGGTTTTTGA
TACGACATTATGTGGTGACTGGGCTGGTGCTACATATAGTAGCTCGGGTTGTCCTGGTACCTGCGAACAAGCAGT
GGCTGATCCGTCCAATTTCAAGAGTGAGTACTCGTCGTTTGTTTTACATTCACCAGATGCCAACGGGATTTTCTA
CAGATGCCAAATGGAAGATTAATTATGTTTCTGTTTATCAGCCAGTCGGATTAGATTACAATTCATCTTATTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail