Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091930
Gene name
Locationscaffold_6:970462..979095
Strand+
Gene length (bp)8633
Transcript length (bp)7086
Coding sequence length (bp)7086
Protein length (aa) 2362

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF02259 FAT FAT domain 5.7E-119 1375 1727
PF00454 PI3_PI4_kinase Phosphatidylinositol 3- and 4-kinase 1.5E-69 2001 2249
PF11865 DUF3385 Domain of unknown function (DUF3385) 1.7E-53 740 898
PF08771 FRB_dom FKBP12-rapamycin binding domain 4.4E-40 1834 1932
PF02260 FATC FATC domain 4.8E-14 2331 2361
PF02985 HEAT HEAT repeat 6.4E-04 707 736
PF13513 HEAT_EZ HEAT-like repeat 1.1E-05 684 733

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 9 2361 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 16 2361 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 7 2361 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 58 2361 0.0E+00
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 34 2361 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 9 2361 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 16 2361 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 7 2361 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 58 2361 0.0E+00
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 34 2361 0.0E+00
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 263 2361 0.0E+00
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 234 2361 0.0E+00
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 16 2361 0.0E+00
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 31 2361 0.0E+00
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 259 2361 0.0E+00
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 1699 2361 0.0E+00
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 234 1687 0.0E+00
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 1699 2361 2.0E-178
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 20 1677 2.0E-161
sp|Q70PP2|SMG1_DROME Serine/threonine-protein kinase Smg1 OS=Drosophila melanogaster GN=nonC PE=1 SV=2 1723 2248 2.0E-65
sp|Q8BKX6|SMG1_MOUSE Serine/threonine-protein kinase SMG1 OS=Mus musculus GN=Smg1 PE=1 SV=3 1723 2248 3.0E-65
sp|Q96Q15|SMG1_HUMAN Serine/threonine-protein kinase SMG1 OS=Homo sapiens GN=SMG1 PE=1 SV=3 1723 2248 4.0E-65
sp|O01510|SMG1_CAEEL Serine/threonine-protein kinase smg-1 OS=Caenorhabditis elegans GN=smg-1 PE=1 SV=3 1723 2248 7.0E-60
sp|Q61CW2|SMG1_CAEBR Serine/threonine-protein kinase smg-1 OS=Caenorhabditis briggsae GN=smg-1 PE=3 SV=3 1723 2248 5.0E-56
sp|Q13315|ATM_HUMAN Serine-protein kinase ATM OS=Homo sapiens GN=ATM PE=1 SV=4 1955 2360 3.0E-51
sp|Q6PQD5|ATM_PIG Serine-protein kinase ATM OS=Sus scrofa GN=ATM PE=3 SV=2 1955 2360 1.0E-50
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 1972 2360 5.0E-50
sp|Q9M3G7|ATM_ARATH Serine/threonine-protein kinase ATM OS=Arabidopsis thaliana GN=ATM PE=2 SV=1 1972 2360 1.0E-49
sp|Q02099|RAD3_SCHPO Protein kinase rad3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rad3 PE=1 SV=2 1975 2361 9.0E-49
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 1972 2360 1.0E-48
sp|Q59LR2|ATR_CANAL Serine/threonine-protein kinase MEC1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=MEC1 PE=3 SV=1 1954 2360 2.0E-48
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 1972 2360 3.0E-48
sp|Q62388|ATM_MOUSE Serine-protein kinase ATM OS=Mus musculus GN=Atm PE=1 SV=2 1949 2360 5.0E-48
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 1941 2361 1.0E-47
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 1965 2248 1.0E-46
sp|Q9VXG8|ATR_DROME Serine/threonine-protein kinase ATR OS=Drosophila melanogaster GN=mei-41 PE=1 SV=2 1970 2360 1.0E-45
sp|Q5EAK6|ATM_DROME Serine/threonine-protein kinase ATM OS=Drosophila melanogaster GN=tefu PE=2 SV=1 1957 2357 4.0E-45
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 1972 2361 6.0E-45
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 1972 2361 6.0E-45
sp|Q9DEI1|PRKDC_XENLA DNA-dependent protein kinase catalytic subunit OS=Xenopus laevis GN=prkdc PE=2 SV=1 1704 2357 9.0E-45
sp|Q4IB89|ATM_GIBZE Serine/threonine-protein kinase TEL1 OS=Gibberella zeae (strain PH-1 / ATCC MYA-4620 / FGSC 9075 / NRRL 31084) GN=TEL1 PE=3 SV=1 1972 2360 5.0E-44
sp|Q7RZT9|ATM_NEUCR Serine/threonine-protein kinase tel1 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=mus-21 PE=3 SV=2 1972 2360 5.0E-43
sp|O74630|ATM_SCHPO Serine/threonine-protein kinase tel1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tel1 PE=1 SV=1 1954 2360 6.0E-43
sp|Q6BV76|ATM_DEBHA Serine/threonine-protein kinase TEL1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=TEL1 PE=3 SV=3 1988 2361 8.0E-43
sp|Q4WVM7|ATM_ASPFU Serine/threonine-protein kinase tel1 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=tel1 PE=3 SV=2 1969 2360 8.0E-43
sp|Q6CP76|ATM_KLULA Serine/threonine-protein kinase TEL1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=TEL1 PE=3 SV=1 1988 2361 1.0E-42
sp|P97313|PRKDC_MOUSE DNA-dependent protein kinase catalytic subunit OS=Mus musculus GN=Prkdc PE=1 SV=3 1696 2357 1.0E-42
sp|Q751J3|ATM_ASHGO Serine/threonine-protein kinase TEL1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=TEL1 PE=3 SV=1 1988 2361 2.0E-41
sp|Q6FX42|ATR_CANGA Serine/threonine-protein kinase MEC1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=MEC1 PE=3 SV=1 1946 2289 1.0E-40
sp|Q2U639|ATM_ASPOR Serine/threonine-protein kinase tel1 OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=tel1 PE=3 SV=1 1954 2360 1.0E-40
sp|Q6FRZ9|ATM_CANGA Serine/threonine-protein kinase TEL1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=TEL1 PE=3 SV=1 1867 2361 2.0E-40
sp|Q5ABX0|ATM_CANAL Serine/threonine-protein kinase TEL1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=TEL1 PE=3 SV=1 1997 2361 5.0E-40
sp|Q5BHE2|ATM_EMENI Serine/threonine-protein kinase tel1 OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=tel1 PE=3 SV=1 1971 2360 7.0E-40
sp|Q8WN22|PRKDC_CANLF DNA-dependent protein kinase catalytic subunit OS=Canis lupus familiaris GN=PRKDC PE=2 SV=1 1782 2357 4.0E-39
sp|P38111|ATR_YEAST Serine/threonine-protein kinase MEC1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MEC1 PE=1 SV=1 1953 2243 4.0E-39
sp|P78527|PRKDC_HUMAN DNA-dependent protein kinase catalytic subunit OS=Homo sapiens GN=PRKDC PE=1 SV=3 1679 2357 8.0E-39
sp|Q8QGX4|PRKDC_CHICK DNA-dependent protein kinase catalytic subunit OS=Gallus gallus GN=PRKDC PE=2 SV=1 1776 2357 2.0E-38
sp|Q75DB8|ATR_ASHGO Serine/threonine-protein kinase MEC1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=MEC1 PE=3 SV=3 1970 2264 7.0E-38
sp|Q6CAD2|ATM_YARLI Serine/threonine-protein kinase TEL1 OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=TEL1 PE=3 SV=1 1988 2361 2.0E-37
sp|Q54UC0|PRKDC_DICDI DNA-dependent protein kinase catalytic subunit OS=Dictyostelium discoideum GN=dnapkcs PE=3 SV=2 1956 2255 4.0E-37
sp|Q6CT34|ATR_KLULA Serine/threonine-protein kinase MEC1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=MEC1 PE=3 SV=1 1954 2247 5.0E-37
sp|P38110|ATM_YEAST Serine/threonine-protein kinase TEL1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TEL1 PE=1 SV=3 1988 2361 2.0E-35
sp|Q8SSE7|ATR_ENCCU Probable serine/threonine-protein kinase MEC1 homolog OS=Encephalitozoon cuniculi (strain GB-M1) GN=MEC1 PE=3 SV=2 1928 2249 1.0E-34
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 12 276 1.0E-32
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 12 276 2.0E-32
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 12 276 2.0E-32
sp|P0CP61|ATM_CRYNB Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=TEL1 PE=3 SV=1 1920 2357 1.0E-31
sp|P0CP60|ATM_CRYNJ Serine/threonine-protein kinase TEL1 OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=TEL1 PE=3 SV=1 1920 2357 2.0E-31
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 2103 2249 1.0E-29
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 18 268 5.0E-26
sp|Q9N3Q4|ATM_CAEEL Serine/threonine-protein kinase ATM OS=Caenorhabditis elegans GN=atm-1 PE=3 SV=3 1956 2360 5.0E-21
sp|Q22258|ATR_CAEEL Serine/threonine-protein kinase ATR OS=Caenorhabditis elegans GN=atl-1 PE=2 SV=2 1972 2229 6.0E-21
sp|Q9FKS4|ATR_ARATH Serine/threonine-protein kinase ATR OS=Arabidopsis thaliana GN=ATR PE=2 SV=2 1239 1814 2.0E-18
sp|Q5Z987|ATR_ORYSJ Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. japonica GN=Os06g0724700 PE=2 SV=1 1220 1840 3.0E-18
sp|A2YH41|ATR_ORYSI Serine/threonine-protein kinase ATR OS=Oryza sativa subsp. indica GN=OsI_023634 PE=3 SV=2 1220 1840 3.0E-18
sp|Q553E9|SMG1_DICDI Probable serine/threonine-protein kinase smg1 OS=Dictyostelium discoideum GN=smg1 PE=3 SV=1 1757 2078 3.0E-18
sp|Q54ER4|ATR1_DICDI Probable serine/threonine-protein kinase atr1 OS=Dictyostelium discoideum GN=atr1 PE=3 SV=1 1313 1831 5.0E-16
sp|P38811|TRA1_YEAST Transcription-associated protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TRA1 PE=1 SV=1 1277 2248 7.0E-15
sp|Q9DE14|ATR_XENLA Serine/threonine-protein kinase atr OS=Xenopus laevis GN=atr PE=1 SV=2 1241 1822 5.0E-14
sp|Q9JKK8|ATR_MOUSE Serine/threonine-protein kinase ATR OS=Mus musculus GN=Atr PE=1 SV=2 1241 1816 2.0E-10
sp|Q13535|ATR_HUMAN Serine/threonine-protein kinase ATR OS=Homo sapiens GN=ATR PE=1 SV=3 1241 1816 1.0E-09
sp|P50520|VPS34_SCHPO Phosphatidylinositol 3-kinase vps34 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=vps34 PE=2 SV=2 1980 2241 1.0E-09
sp|Q10064|YAMB_SCHPO Uncharacterized PI3/PI4-kinase family protein C1F5.11c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC1F5.11c PE=3 SV=1 1956 2213 4.0E-09
sp|Q9HFE8|TRA1_SCHPO Transcription-associated protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tra1 PE=3 SV=1 1918 2291 8.0E-07
sp|Q9UW24|PIK1A_CANAL Phosphatidylinositol 4-kinase PIK1a OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=PIKA PE=3 SV=1 1985 2238 1.0E-06
sp|Q80YV3|TRRAP_MOUSE Transformation/transcription domain-associated protein OS=Mus musculus GN=Trrap PE=1 SV=2 1932 2248 3.0E-06
sp|P54677|PI4K_DICDI Phosphatidylinositol 4-kinase OS=Dictyostelium discoideum GN=pikD PE=3 SV=3 1999 2255 3.0E-06
sp|Q9Y4A5|TRRAP_HUMAN Transformation/transcription domain-associated protein OS=Homo sapiens GN=TRRAP PE=1 SV=3 1645 2248 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0044877 protein-containing complex binding Yes
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091930
MAPNAQTPAEKLSAIFTGLKNRNADIRVQNAKELRRFVLTEVADMSSDASAKIWDETIIRNVIALTHSQNTMEAY
GGLMAIDYLLGTESDEIEAKRNLFRFYNYVKHLLRNHEVSLMLYASKTLGRIAEIGGSAFGESFMDYEVQAAIEL
IQPDKNESSRHAGVLILKELARNSPTYFHQHIGVVFDNILIPLRDPRVHIREGTAELLAACLEIVTTRERQTRSP
YLSKMLQDAHQGLKGSSMDIVHGSLLTYRELLLHAGMFMKENYLDIAEQILRYKSHRDPLIRKMVITMIPSLAVY
DTQTFTEHFLHKAMGHLLTQLEKPAERNYAFIAIGHTANAIGSDMKPFLDSIMNQIKIGLQGRGRKNAPNEEPLF
QCMGMLAAAVGPNLTKLLHDQLDLMMSCGLSEPLKNALAIIAKHIPPLLKTIQDRLLDLLSQVLSGQPYKPLGAP
PLASRQDGSGIMSNVPPQASHDKSPELITLALTTLGSFDFSGHVLNEFVRNCAVPYLEDDQPEVRRAAALTCCRL
FVRDPICYQSSSHAIEIISDVLDKLLTVGIADPDPSIRQTVLGALHEKFDKHLAQAENVRSLFIALNDEVFENRM
IAVGLIGRLARHNPAYVMPSLRKALIQLLTELEYSTVLRSREECTRLLTLLVSCTQRLIKPYALPMLRVLIQKAN
DVNPTVSANVLMCLGELVCIAGEDALPHVPDLMAVIIARLSDPSISKRDAALRALGQLCSSTGYVITPLVEYPQL
VPLLSRILKSDGAKNMRREVVKVLGILGALDPYRRKTRPDDEAVSEKAVTAVIQVPVAQFNAVSGADDYFQTVVI
NSLLVILKDQALSSHHHTVIEAVMSIFKTQGLKCVTFLPQIIPAFASVTRTSSVARLQEFHLQQLAILVEIIKQH
VRNYMPEIFALVTELWENSALQLPIVALIEALGKALDAEFKPFLPTILPLILKVFEGGPPDDKRSSVQIKVFDAF
LTFGSNIEEYLHLVIPIIVKTYERDGSTQLRKKAIQTIHGLSRRVNFSDHASRIIHPLARVLDNSNTELRISVME
TLCSLMMQLGADFAIFVPTINKSIMRNKVAPHHVYENMISKLLNGEPLPQDMALQDSLEPNKTPEFTAPAEASKM
AVNQQHLKQAWDVSQIATREDWFEWIHRLSVEFMKESPSHALRACMGLVDIHPPLAKELFNAAFLSCWSELYDQY
QEDLVRSVEHAITSNDAPPELIHRLLNLAEFMEHEEKPLPIEHRTLGEYAMKYMAYAKALHYKELEYFSEASPAV
VESLISINTRLQQHDAAWGTLMTAKEQYNVTEHEEWYERLGRWQEALVAYEKAAENDPSDLEVQFGRMKCLHALG
EWDQLATRVNEHWATASHDDRREIAPMAAAAAWSLNAWDDMEDYINTMKSDSPDRAFYRAILFVQQNQFPKALSQ
IAKARDLLDPELSSFVGDSYGRLYGVMVRAQMLSELEEIIAFKQYADQPERQLTMRKTWLKRLQGCQPDVEIWQR
ILQVRTLVLNPEDDPVMWIKFANLCRKNDRMPLAEKTINSLLSPERFRLQDHHTKATPNVVYAHLKYMWAQSKES
RHESLEFLRRFTEELAHDLSQEVSENSHHRLATPLSKQKLTELSKLLARCYYKQGEWQTQLGVNWGTRNTEEILH
AYYLATHYDTVWYKAWHTWALTNFEVVSELEAQAEGRTVDIPGEGIAAHVVQAVEGFFRSIALKNVDALQDILRL
LTLWFKFGAHDDVSDAMANGFSTVEVDTWLEVVPQIIARIQTPSINIRRTISNLLTDIGKHHPQALIYPLTVASK
SSSVARMKAAQAIMDRMGEHSPLIVTQAQSVSQELIRVAILWHELWHEGLEEASRLYFTEKNPDGMIAALEPLHD
LLEKGPRTARETSFVQAFGRELHEAREACRRFRIYGETAELDRAWDIYYGVFKRVEKQLPQLTSLDLQYVSPLLL
KARNLELAVPGTYQSGRAIIRIQSFATKLTVIASKQRPRRLCLRGEDGRDYQYILKGHEDLRQDERVMQLFGLVN
TLLSVDTNSFKRRLHIQRYPVIPLAPNAGLLGWVQDSDTLHVLIRDYRDSRKVLLNIEYRLMLQMAPDYENLTLL
QKVEVFEYALENTTGQDLYRVLWLKSTNSEHWLERRATYTRSLAVNSMVGHILGLGDRHPSNLLLERSTGKVVHI
DFGDCFEVAMHREKFPEKVPFRLTRMLTHAMEVSGIEGSFKNTCEITMTVLRDNKDSLLAVLEAFVYDPLINWRL
MQTEVEGRRNEVDPDRAAELARVAAHPQGPQRKLKANENDIFNETQGEPGAQEIRNERALFVFHRVQHKLTGRDF
NPEITLSIRDQVEKLIDSATALENLCQCFSGWCAFW*
Coding >AgabiH97|091930
ATGGCGCCTAACGCTCAGACGCCAGCAGAGAAGCTCTCTGCTATCTTTACTGGCCTCAAAAACCGTAATGCAGAT
ATTCGTGTGCAGAATGCCAAGGAACTGCGTCGTTTTGTTTTAACTGAGGTTGCCGATATGTCTTCGGATGCTTCA
GCCAAAATTTGGGATGAGACTATAATCAGAAATGTCATTGCGTTAACGCACAGTCAGAATACGATGGAGGCATAT
GGTGGTTTGATGGCAATAGATTACCTCCTCGGTACCGAATCTGACGAGATTGAGGCGAAGCGAAACCTCTTTCGA
TTTTACAATTACGTTAAGCATTTACTGCGAAATCATGAAGTTTCCCTTATGCTGTATGCTTCAAAAACGCTGGGA
CGAATAGCAGAAATTGGAGGTTCTGCATTTGGAGAAAGCTTTATGGACTACGAGGTTCAAGCTGCCATCGAGCTG
ATACAACCGGACAAAAACGAGTCTTCGCGTCATGCTGGTGTTCTCATTCTGAAGGAATTAGCTCGCAACAGTCCT
ACGTACTTTCACCAGCACATAGGTGTTGTATTCGACAACATTCTAATACCTCTACGTGATCCTCGGGTCCATATC
CGCGAAGGGACAGCAGAATTATTGGCAGCTTGCCTTGAAATAGTCACCACTCGAGAGCGTCAAACGAGGAGTCCA
TATCTTTCTAAAATGCTGCAGGATGCTCATCAAGGCCTAAAAGGAAGCTCGATGGACATTGTGCACGGTTCACTG
TTGACATATCGCGAGTTATTACTCCACGCTGGAATGTTCATGAAGGAGAATTACCTCGATATTGCTGAACAGATT
CTCCGGTACAAGTCACATCGAGATCCCCTCATCCGAAAAATGGTGATAACAATGATTCCATCCTTGGCTGTTTAC
GACACACAGACCTTCACCGAACATTTCCTACACAAAGCGATGGGTCACCTTTTGACGCAGCTGGAAAAACCAGCT
GAACGGAATTACGCGTTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTAGAC
TCTATTATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGACGCAAGAATGCTCCGAACGAAGAGCCGCTCTTC
CAATGTATGGGGATGTTGGCGGCAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTCATG
ATGAGCTGCGGGTTGAGTGAGCCATTGAAGAATGCGCTTGCTATCATTGCGAAACACATACCTCCTCTACTCAAA
ACAATTCAAGATCGATTACTGGATCTCCTATCACAGGTTCTAAGTGGACAACCGTACAAGCCTTTGGGTGCTCCT
CCGCTTGCCAGCAGACAAGATGGTTCTGGTATCATGTCCAATGTTCCTCCTCAAGCATCTCACGACAAAAGTCCT
GAGTTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAGTGGGCATGTACTCAATGAATTTGTACGG
AATTGCGCCGTTCCTTATCTCGAAGATGACCAACCCGAAGTTCGCCGAGCAGCTGCGTTGACTTGTTGTCGGCTT
TTTGTTCGCGATCCCATCTGCTATCAGTCAAGCAGCCATGCCATCGAGATTATCAGCGATGTACTAGACAAGCTG
TTAACAGTGGGCATCGCTGATCCTGATCCATCAATTCGGCAGACGGTGCTTGGTGCTCTACATGAAAAGTTTGAC
AAACACTTGGCACAGGCAGAGAATGTTCGCTCACTGTTCATCGCTTTAAATGATGAGGTATTTGAAAACCGCATG
ATTGCGGTGGGTCTTATTGGGCGGCTAGCAAGACACAATCCTGCCTATGTGATGCCATCCCTGCGTAAAGCGTTG
ATTCAGCTCCTGACTGAGCTTGAATACTCAACTGTACTTCGAAGTCGCGAGGAATGCACGCGGTTATTGACGCTT
CTAGTAAGCTGTACGCAGCGGTTAATCAAACCCTACGCCCTACCCATGCTTCGGGTCTTAATACAAAAAGCGAAT
GACGTCAACCCGACAGTTTCTGCCAATGTCCTTATGTGTTTAGGGGAGCTCGTTTGTATTGCTGGGGAAGACGCG
CTTCCCCATGTACCTGACTTGATGGCAGTTATCATTGCAAGGCTTTCGGATCCATCGATCAGTAAGAGGGATGCT
GCACTCCGTGCTTTGGGTCAATTATGCTCTAGCACGGGCTATGTCATCACTCCCTTAGTGGAGTATCCGCAGTTG
GTACCGCTACTGTCCAGAATTCTCAAATCTGATGGAGCCAAAAATATGAGACGGGAAGTAGTGAAGGTGTTGGGC
ATTCTTGGTGCACTGGACCCATATAGGCGGAAGACGCGACCTGATGACGAGGCCGTGAGCGAGAAGGCCGTCACT
GCCGTTATACAGGTACCGGTGGCGCAGTTCAACGCAGTCTCCGGAGCCGATGATTACTTTCAAACCGTGGTTATC
AACTCCCTTCTCGTCATTCTCAAGGACCAGGCTTTGAGTAGCCATCATCATACCGTGATTGAAGCCGTGATGTCT
ATATTCAAGACCCAGGGTTTGAAATGCGTCACTTTCTTACCACAGATCATTCCGGCCTTCGCGTCAGTTACTCGG
ACATCTTCTGTCGCTCGGCTGCAGGAGTTCCATCTACAACAACTCGCTATTTTGGTTGAGATCATCAAGCAACAT
GTCCGAAATTATATGCCGGAAATCTTTGCCCTTGTTACTGAACTTTGGGAAAATTCAGCCCTTCAGCTCCCTATC
GTGGCTTTGATAGAAGCTTTGGGTAAAGCGCTTGACGCGGAGTTCAAACCATTCCTTCCTACCATTCTGCCCCTC
ATTCTCAAAGTCTTTGAAGGAGGTCCTCCTGATGACAAACGAAGTTCTGTCCAGATCAAGGTCTTCGATGCGTTC
CTTACCTTTGGTTCGAACATCGAGGAATACCTTCATTTGGTGATACCGATTATTGTGAAGACATATGAGCGCGAT
GGTAGTACTCAGCTTCGCAAGAAAGCTATTCAAACAATTCATGGGTTGTCACGAAGAGTCAACTTTTCGGATCAT
GCGTCTCGCATTATTCATCCTTTGGCTCGGGTGCTGGATAATTCCAATACGGAGCTCAGAATTTCGGTCATGGAA
ACGTTGTGTTCTTTAATGATGCAACTTGGAGCCGATTTTGCCATTTTTGTTCCTACTATCAATAAGAGTATCATG
CGAAACAAGGTTGCTCCTCATCACGTTTATGAGAACATGATTAGCAAACTTCTGAATGGTGAACCACTACCTCAG
GATATGGCCCTACAGGATTCGCTTGAACCAAACAAAACTCCAGAATTTACAGCCCCTGCCGAAGCGTCCAAGATG
GCCGTTAACCAACAGCATCTTAAGCAAGCGTGGGACGTGTCTCAGATTGCTACTCGAGAAGACTGGTTTGAGTGG
ATTCACCGGCTTAGTGTTGAGTTTATGAAGGAATCTCCATCCCATGCCCTCCGAGCGTGTATGGGTCTCGTTGAT
ATACACCCTCCCCTTGCGAAAGAACTTTTCAACGCCGCTTTTCTCTCTTGCTGGAGCGAGCTGTATGACCAGTAT
CAGGAGGACCTGGTTCGCTCTGTCGAACATGCAATTACATCAAACGACGCACCCCCAGAGCTTATACATCGTCTA
CTGAACCTGGCGGAGTTCATGGAACATGAAGAAAAACCACTTCCTATTGAGCATCGAACCCTCGGCGAGTATGCG
ATGAAGTACATGGCATACGCTAAAGCTCTTCACTACAAGGAACTGGAGTACTTCTCGGAAGCTTCTCCTGCTGTC
GTTGAGTCTCTCATATCCATCAACACACGCCTACAACAACATGACGCCGCGTGGGGTACTCTCATGACCGCTAAA
GAACAATATAACGTGACCGAACATGAAGAGTGGTATGAGAGGTTGGGCCGCTGGCAAGAGGCGCTAGTTGCATAC
GAGAAAGCGGCCGAAAATGACCCGAGTGATCTCGAAGTTCAATTTGGACGGATGAAATGTCTTCACGCACTTGGG
GAATGGGATCAATTAGCGACACGCGTCAATGAGCACTGGGCCACTGCCTCCCATGATGATCGTCGAGAGATTGCA
CCAATGGCGGCGGCAGCGGCTTGGTCGCTCAATGCGTGGGATGACATGGAAGACTACATCAACACTATGAAGTCC
GACTCTCCAGATCGAGCGTTCTACAGAGCTATTCTTTTCGTTCAGCAAAATCAATTTCCCAAGGCTTTGTCACAA
ATAGCGAAGGCCCGTGACTTGCTAGACCCCGAACTCAGTTCTTTCGTTGGAGATAGTTATGGGCGACTTTATGGT
GTTATGGTTCGCGCTCAGATGCTATCAGAGCTGGAGGAAATTATTGCCTTCAAGCAGTATGCGGATCAGCCCGAA
AGGCAGCTAACGATGCGGAAGACGTGGCTCAAGAGGTTGCAGGGCTGCCAGCCAGACGTTGAAATATGGCAGAGG
ATCCTGCAAGTGCGAACGCTGGTTTTGAACCCGGAAGACGACCCAGTCATGTGGATCAAATTTGCTAATCTGTGT
CGAAAGAACGATCGCATGCCGCTGGCCGAGAAAACCATCAATTCGTTATTGTCGCCAGAGAGGTTTCGGCTCCAA
GATCATCATACCAAGGCGACCCCGAATGTTGTATATGCTCACCTGAAGTATATGTGGGCTCAGTCCAAGGAGTCC
AGACATGAGAGTCTGGAGTTTCTTCGTCGATTCACTGAAGAGCTCGCGCACGACCTAAGCCAGGAAGTGAGCGAA
AATTCGCACCATCGGCTTGCCACCCCGCTTTCGAAGCAGAAGCTGACGGAATTATCAAAGCTCCTTGCGCGATGT
TATTATAAGCAAGGTGAATGGCAGACTCAGCTCGGTGTAAATTGGGGCACCAGGAACACGGAGGAAATTTTGCAT
GCTTATTACCTAGCTACACACTACGACACTGTGTGGTACAAAGCCTGGCATACTTGGGCTCTGACTAATTTCGAA
GTTGTAAGTGAACTGGAGGCTCAAGCTGAAGGTCGGACAGTCGATATACCGGGAGAAGGCATTGCCGCACATGTC
GTTCAAGCGGTTGAAGGGTTTTTCCGTTCCATTGCCCTGAAAAATGTTGACGCGCTTCAAGATATACTGCGGCTA
CTTACTCTCTGGTTCAAGTTTGGTGCACATGACGATGTCAGTGACGCGATGGCCAATGGATTTTCTACCGTAGAA
GTTGATACATGGCTAGAAGTTGTTCCGCAGATCATTGCCCGTATCCAAACGCCATCAATCAACATACGTCGCACC
ATCAGCAATCTTCTCACCGACATCGGGAAGCATCATCCACAGGCACTCATATATCCCCTGACTGTTGCGTCTAAA
TCTTCAAGCGTCGCTCGAATGAAAGCTGCTCAGGCTATCATGGATCGGATGGGCGAACACAGCCCATTGATCGTG
ACTCAGGCACAATCGGTCAGCCAAGAGCTTATTCGCGTAGCTATTCTATGGCATGAATTGTGGCATGAAGGTTTG
GAGGAAGCGTCGAGGCTGTATTTCACAGAAAAGAACCCAGATGGGATGATAGCTGCCCTGGAACCGTTGCATGAC
CTTTTAGAAAAGGGACCACGAACTGCCCGCGAAACTTCATTTGTTCAAGCCTTTGGACGTGAGCTTCATGAAGCC
CGCGAAGCCTGTCGCCGATTCCGTATCTATGGAGAAACCGCAGAGTTAGACAGAGCCTGGGACATATACTACGGG
GTATTCAAGCGCGTCGAGAAGCAGTTGCCCCAACTTACCTCTCTCGACTTGCAATATGTATCACCTCTGCTTCTT
AAAGCTCGGAATCTTGAACTAGCCGTCCCGGGAACTTACCAGAGCGGCAGGGCTATCATTCGGATACAGAGTTTT
GCAACGAAACTAACAGTCATTGCATCCAAACAGAGACCACGACGACTGTGTCTGAGGGGTGAGGATGGACGCGAT
TATCAATATATTCTTAAAGGTCACGAAGATCTCCGTCAAGATGAACGAGTCATGCAGCTGTTTGGCTTGGTCAAC
ACATTGCTCTCCGTCGACACGAATAGCTTTAAACGTCGCCTCCACATTCAGCGTTATCCCGTTATCCCGCTCGCT
CCGAATGCGGGTTTGCTAGGCTGGGTGCAAGACAGTGATACCTTACATGTCCTCATCCGTGACTACCGTGATTCA
AGGAAGGTCCTCCTCAACATTGAGTATCGACTGATGCTCCAGATGGCTCCCGATTACGAGAATCTCACCTTGTTG
CAAAAGGTCGAAGTTTTCGAGTATGCACTGGAGAATACCACTGGTCAGGATTTATACCGTGTATTATGGCTCAAG
AGTACCAACTCTGAGCATTGGTTGGAGCGCCGAGCAACATACACCCGGTCACTTGCTGTGAACAGTATGGTTGGG
CATATACTCGGATTGGGCGATCGACATCCTTCCAATCTCTTGTTAGAGCGAAGTACAGGAAAAGTTGTTCATATC
GACTTCGGTGATTGTTTCGAAGTCGCAATGCACCGCGAGAAGTTCCCAGAGAAAGTACCATTCCGGCTGACGAGG
ATGTTGACCCATGCTATGGAGGTCAGCGGCATCGAGGGAAGCTTCAAGAATACTTGCGAAATTACCATGACAGTA
CTGCGGGATAATAAAGATTCCCTTCTGGCTGTCCTGGAGGCGTTCGTATACGATCCTTTGATCAATTGGCGATTG
ATGCAGACCGAAGTTGAAGGCCGACGCAATGAAGTGGATCCTGATCGCGCTGCTGAGCTAGCGCGCGTGGCTGCG
CATCCTCAAGGCCCCCAACGGAAGCTTAAAGCGAATGAGAACGATATTTTCAATGAAACCCAAGGAGAACCCGGT
GCCCAAGAAATACGTAATGAACGAGCACTTTTCGTTTTCCACCGCGTCCAGCATAAGCTTACTGGCCGTGACTTC
AACCCGGAAATTACTTTGTCAATTCGTGATCAAGTTGAGAAACTCATTGATTCAGCGACCGCCCTTGAAAATCTC
TGCCAATGCTTCTCAGGTTGGTGCGCGTTCTGGTAG
Transcript >AgabiH97|091930
ATGGCGCCTAACGCTCAGACGCCAGCAGAGAAGCTCTCTGCTATCTTTACTGGCCTCAAAAACCGTAATGCAGAT
ATTCGTGTGCAGAATGCCAAGGAACTGCGTCGTTTTGTTTTAACTGAGGTTGCCGATATGTCTTCGGATGCTTCA
GCCAAAATTTGGGATGAGACTATAATCAGAAATGTCATTGCGTTAACGCACAGTCAGAATACGATGGAGGCATAT
GGTGGTTTGATGGCAATAGATTACCTCCTCGGTACCGAATCTGACGAGATTGAGGCGAAGCGAAACCTCTTTCGA
TTTTACAATTACGTTAAGCATTTACTGCGAAATCATGAAGTTTCCCTTATGCTGTATGCTTCAAAAACGCTGGGA
CGAATAGCAGAAATTGGAGGTTCTGCATTTGGAGAAAGCTTTATGGACTACGAGGTTCAAGCTGCCATCGAGCTG
ATACAACCGGACAAAAACGAGTCTTCGCGTCATGCTGGTGTTCTCATTCTGAAGGAATTAGCTCGCAACAGTCCT
ACGTACTTTCACCAGCACATAGGTGTTGTATTCGACAACATTCTAATACCTCTACGTGATCCTCGGGTCCATATC
CGCGAAGGGACAGCAGAATTATTGGCAGCTTGCCTTGAAATAGTCACCACTCGAGAGCGTCAAACGAGGAGTCCA
TATCTTTCTAAAATGCTGCAGGATGCTCATCAAGGCCTAAAAGGAAGCTCGATGGACATTGTGCACGGTTCACTG
TTGACATATCGCGAGTTATTACTCCACGCTGGAATGTTCATGAAGGAGAATTACCTCGATATTGCTGAACAGATT
CTCCGGTACAAGTCACATCGAGATCCCCTCATCCGAAAAATGGTGATAACAATGATTCCATCCTTGGCTGTTTAC
GACACACAGACCTTCACCGAACATTTCCTACACAAAGCGATGGGTCACCTTTTGACGCAGCTGGAAAAACCAGCT
GAACGGAATTACGCGTTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTAGAC
TCTATTATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGACGCAAGAATGCTCCGAACGAAGAGCCGCTCTTC
CAATGTATGGGGATGTTGGCGGCAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTCATG
ATGAGCTGCGGGTTGAGTGAGCCATTGAAGAATGCGCTTGCTATCATTGCGAAACACATACCTCCTCTACTCAAA
ACAATTCAAGATCGATTACTGGATCTCCTATCACAGGTTCTAAGTGGACAACCGTACAAGCCTTTGGGTGCTCCT
CCGCTTGCCAGCAGACAAGATGGTTCTGGTATCATGTCCAATGTTCCTCCTCAAGCATCTCACGACAAAAGTCCT
GAGTTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAGTGGGCATGTACTCAATGAATTTGTACGG
AATTGCGCCGTTCCTTATCTCGAAGATGACCAACCCGAAGTTCGCCGAGCAGCTGCGTTGACTTGTTGTCGGCTT
TTTGTTCGCGATCCCATCTGCTATCAGTCAAGCAGCCATGCCATCGAGATTATCAGCGATGTACTAGACAAGCTG
TTAACAGTGGGCATCGCTGATCCTGATCCATCAATTCGGCAGACGGTGCTTGGTGCTCTACATGAAAAGTTTGAC
AAACACTTGGCACAGGCAGAGAATGTTCGCTCACTGTTCATCGCTTTAAATGATGAGGTATTTGAAAACCGCATG
ATTGCGGTGGGTCTTATTGGGCGGCTAGCAAGACACAATCCTGCCTATGTGATGCCATCCCTGCGTAAAGCGTTG
ATTCAGCTCCTGACTGAGCTTGAATACTCAACTGTACTTCGAAGTCGCGAGGAATGCACGCGGTTATTGACGCTT
CTAGTAAGCTGTACGCAGCGGTTAATCAAACCCTACGCCCTACCCATGCTTCGGGTCTTAATACAAAAAGCGAAT
GACGTCAACCCGACAGTTTCTGCCAATGTCCTTATGTGTTTAGGGGAGCTCGTTTGTATTGCTGGGGAAGACGCG
CTTCCCCATGTACCTGACTTGATGGCAGTTATCATTGCAAGGCTTTCGGATCCATCGATCAGTAAGAGGGATGCT
GCACTCCGTGCTTTGGGTCAATTATGCTCTAGCACGGGCTATGTCATCACTCCCTTAGTGGAGTATCCGCAGTTG
GTACCGCTACTGTCCAGAATTCTCAAATCTGATGGAGCCAAAAATATGAGACGGGAAGTAGTGAAGGTGTTGGGC
ATTCTTGGTGCACTGGACCCATATAGGCGGAAGACGCGACCTGATGACGAGGCCGTGAGCGAGAAGGCCGTCACT
GCCGTTATACAGGTACCGGTGGCGCAGTTCAACGCAGTCTCCGGAGCCGATGATTACTTTCAAACCGTGGTTATC
AACTCCCTTCTCGTCATTCTCAAGGACCAGGCTTTGAGTAGCCATCATCATACCGTGATTGAAGCCGTGATGTCT
ATATTCAAGACCCAGGGTTTGAAATGCGTCACTTTCTTACCACAGATCATTCCGGCCTTCGCGTCAGTTACTCGG
ACATCTTCTGTCGCTCGGCTGCAGGAGTTCCATCTACAACAACTCGCTATTTTGGTTGAGATCATCAAGCAACAT
GTCCGAAATTATATGCCGGAAATCTTTGCCCTTGTTACTGAACTTTGGGAAAATTCAGCCCTTCAGCTCCCTATC
GTGGCTTTGATAGAAGCTTTGGGTAAAGCGCTTGACGCGGAGTTCAAACCATTCCTTCCTACCATTCTGCCCCTC
ATTCTCAAAGTCTTTGAAGGAGGTCCTCCTGATGACAAACGAAGTTCTGTCCAGATCAAGGTCTTCGATGCGTTC
CTTACCTTTGGTTCGAACATCGAGGAATACCTTCATTTGGTGATACCGATTATTGTGAAGACATATGAGCGCGAT
GGTAGTACTCAGCTTCGCAAGAAAGCTATTCAAACAATTCATGGGTTGTCACGAAGAGTCAACTTTTCGGATCAT
GCGTCTCGCATTATTCATCCTTTGGCTCGGGTGCTGGATAATTCCAATACGGAGCTCAGAATTTCGGTCATGGAA
ACGTTGTGTTCTTTAATGATGCAACTTGGAGCCGATTTTGCCATTTTTGTTCCTACTATCAATAAGAGTATCATG
CGAAACAAGGTTGCTCCTCATCACGTTTATGAGAACATGATTAGCAAACTTCTGAATGGTGAACCACTACCTCAG
GATATGGCCCTACAGGATTCGCTTGAACCAAACAAAACTCCAGAATTTACAGCCCCTGCCGAAGCGTCCAAGATG
GCCGTTAACCAACAGCATCTTAAGCAAGCGTGGGACGTGTCTCAGATTGCTACTCGAGAAGACTGGTTTGAGTGG
ATTCACCGGCTTAGTGTTGAGTTTATGAAGGAATCTCCATCCCATGCCCTCCGAGCGTGTATGGGTCTCGTTGAT
ATACACCCTCCCCTTGCGAAAGAACTTTTCAACGCCGCTTTTCTCTCTTGCTGGAGCGAGCTGTATGACCAGTAT
CAGGAGGACCTGGTTCGCTCTGTCGAACATGCAATTACATCAAACGACGCACCCCCAGAGCTTATACATCGTCTA
CTGAACCTGGCGGAGTTCATGGAACATGAAGAAAAACCACTTCCTATTGAGCATCGAACCCTCGGCGAGTATGCG
ATGAAGTACATGGCATACGCTAAAGCTCTTCACTACAAGGAACTGGAGTACTTCTCGGAAGCTTCTCCTGCTGTC
GTTGAGTCTCTCATATCCATCAACACACGCCTACAACAACATGACGCCGCGTGGGGTACTCTCATGACCGCTAAA
GAACAATATAACGTGACCGAACATGAAGAGTGGTATGAGAGGTTGGGCCGCTGGCAAGAGGCGCTAGTTGCATAC
GAGAAAGCGGCCGAAAATGACCCGAGTGATCTCGAAGTTCAATTTGGACGGATGAAATGTCTTCACGCACTTGGG
GAATGGGATCAATTAGCGACACGCGTCAATGAGCACTGGGCCACTGCCTCCCATGATGATCGTCGAGAGATTGCA
CCAATGGCGGCGGCAGCGGCTTGGTCGCTCAATGCGTGGGATGACATGGAAGACTACATCAACACTATGAAGTCC
GACTCTCCAGATCGAGCGTTCTACAGAGCTATTCTTTTCGTTCAGCAAAATCAATTTCCCAAGGCTTTGTCACAA
ATAGCGAAGGCCCGTGACTTGCTAGACCCCGAACTCAGTTCTTTCGTTGGAGATAGTTATGGGCGACTTTATGGT
GTTATGGTTCGCGCTCAGATGCTATCAGAGCTGGAGGAAATTATTGCCTTCAAGCAGTATGCGGATCAGCCCGAA
AGGCAGCTAACGATGCGGAAGACGTGGCTCAAGAGGTTGCAGGGCTGCCAGCCAGACGTTGAAATATGGCAGAGG
ATCCTGCAAGTGCGAACGCTGGTTTTGAACCCGGAAGACGACCCAGTCATGTGGATCAAATTTGCTAATCTGTGT
CGAAAGAACGATCGCATGCCGCTGGCCGAGAAAACCATCAATTCGTTATTGTCGCCAGAGAGGTTTCGGCTCCAA
GATCATCATACCAAGGCGACCCCGAATGTTGTATATGCTCACCTGAAGTATATGTGGGCTCAGTCCAAGGAGTCC
AGACATGAGAGTCTGGAGTTTCTTCGTCGATTCACTGAAGAGCTCGCGCACGACCTAAGCCAGGAAGTGAGCGAA
AATTCGCACCATCGGCTTGCCACCCCGCTTTCGAAGCAGAAGCTGACGGAATTATCAAAGCTCCTTGCGCGATGT
TATTATAAGCAAGGTGAATGGCAGACTCAGCTCGGTGTAAATTGGGGCACCAGGAACACGGAGGAAATTTTGCAT
GCTTATTACCTAGCTACACACTACGACACTGTGTGGTACAAAGCCTGGCATACTTGGGCTCTGACTAATTTCGAA
GTTGTAAGTGAACTGGAGGCTCAAGCTGAAGGTCGGACAGTCGATATACCGGGAGAAGGCATTGCCGCACATGTC
GTTCAAGCGGTTGAAGGGTTTTTCCGTTCCATTGCCCTGAAAAATGTTGACGCGCTTCAAGATATACTGCGGCTA
CTTACTCTCTGGTTCAAGTTTGGTGCACATGACGATGTCAGTGACGCGATGGCCAATGGATTTTCTACCGTAGAA
GTTGATACATGGCTAGAAGTTGTTCCGCAGATCATTGCCCGTATCCAAACGCCATCAATCAACATACGTCGCACC
ATCAGCAATCTTCTCACCGACATCGGGAAGCATCATCCACAGGCACTCATATATCCCCTGACTGTTGCGTCTAAA
TCTTCAAGCGTCGCTCGAATGAAAGCTGCTCAGGCTATCATGGATCGGATGGGCGAACACAGCCCATTGATCGTG
ACTCAGGCACAATCGGTCAGCCAAGAGCTTATTCGCGTAGCTATTCTATGGCATGAATTGTGGCATGAAGGTTTG
GAGGAAGCGTCGAGGCTGTATTTCACAGAAAAGAACCCAGATGGGATGATAGCTGCCCTGGAACCGTTGCATGAC
CTTTTAGAAAAGGGACCACGAACTGCCCGCGAAACTTCATTTGTTCAAGCCTTTGGACGTGAGCTTCATGAAGCC
CGCGAAGCCTGTCGCCGATTCCGTATCTATGGAGAAACCGCAGAGTTAGACAGAGCCTGGGACATATACTACGGG
GTATTCAAGCGCGTCGAGAAGCAGTTGCCCCAACTTACCTCTCTCGACTTGCAATATGTATCACCTCTGCTTCTT
AAAGCTCGGAATCTTGAACTAGCCGTCCCGGGAACTTACCAGAGCGGCAGGGCTATCATTCGGATACAGAGTTTT
GCAACGAAACTAACAGTCATTGCATCCAAACAGAGACCACGACGACTGTGTCTGAGGGGTGAGGATGGACGCGAT
TATCAATATATTCTTAAAGGTCACGAAGATCTCCGTCAAGATGAACGAGTCATGCAGCTGTTTGGCTTGGTCAAC
ACATTGCTCTCCGTCGACACGAATAGCTTTAAACGTCGCCTCCACATTCAGCGTTATCCCGTTATCCCGCTCGCT
CCGAATGCGGGTTTGCTAGGCTGGGTGCAAGACAGTGATACCTTACATGTCCTCATCCGTGACTACCGTGATTCA
AGGAAGGTCCTCCTCAACATTGAGTATCGACTGATGCTCCAGATGGCTCCCGATTACGAGAATCTCACCTTGTTG
CAAAAGGTCGAAGTTTTCGAGTATGCACTGGAGAATACCACTGGTCAGGATTTATACCGTGTATTATGGCTCAAG
AGTACCAACTCTGAGCATTGGTTGGAGCGCCGAGCAACATACACCCGGTCACTTGCTGTGAACAGTATGGTTGGG
CATATACTCGGATTGGGCGATCGACATCCTTCCAATCTCTTGTTAGAGCGAAGTACAGGAAAAGTTGTTCATATC
GACTTCGGTGATTGTTTCGAAGTCGCAATGCACCGCGAGAAGTTCCCAGAGAAAGTACCATTCCGGCTGACGAGG
ATGTTGACCCATGCTATGGAGGTCAGCGGCATCGAGGGAAGCTTCAAGAATACTTGCGAAATTACCATGACAGTA
CTGCGGGATAATAAAGATTCCCTTCTGGCTGTCCTGGAGGCGTTCGTATACGATCCTTTGATCAATTGGCGATTG
ATGCAGACCGAAGTTGAAGGCCGACGCAATGAAGTGGATCCTGATCGCGCTGCTGAGCTAGCGCGCGTGGCTGCG
CATCCTCAAGGCCCCCAACGGAAGCTTAAAGCGAATGAGAACGATATTTTCAATGAAACCCAAGGAGAACCCGGT
GCCCAAGAAATACGTAATGAACGAGCACTTTTCGTTTTCCACCGCGTCCAGCATAAGCTTACTGGCCGTGACTTC
AACCCGGAAATTACTTTGTCAATTCGTGATCAAGTTGAGAAACTCATTGATTCAGCGACCGCCCTTGAAAATCTC
TGCCAATGCTTCTCAGGTTGGTGCGCGTTCTGGTAG
Gene >AgabiH97|091930
ATGGCGCCTAACGCTCAGACGCCAGCAGAGAAGCTCTCTGCTATCTTTACTGGCCTCAAAAACCGTAATGCAGAT
ATTCGTGTGCAGAATGCCAAGGAACTGCGTCGTTTTGTGGGTCTGGAAACAACATTGGACCTTATATCTGTTTCA
ATTAACTATGGATTTAATAGGTTTTAACTGAGGTTGCCGATATGTCTTCGGATGCTTCAGCCAAAATTTGGGATG
AGACTATAATCAGAAATGTCATTGCGTTAACGCACAGTCAGAATACGATGGAGGCATATGGTGGTTTGATGGCAA
TAGGTGCGTACATCGTTCTTCAGACTTTGTCTTCTGTTTAATTTGCAGTAGATTACCTCCTCGGTACCGAATCTG
ACGAGATTGAGGCGAAGCGAAACCTCTTTCGATTTTACAATTACGTTAAGCATTTACTGCGAAATCATGAAGTTT
CCCTTATGCTGTATGCTTCAAAAACGCTGGGACGAATAGCAGAAATTGGAGGTTCTGCATTTGGAGAAAGCTTTA
TGGACTACGAGGTTCAAGCTGCCATCGAGCTGATACAACCGGACAAAAACGAGTCTTCGCGTCATGCTGGTGTTC
TCATTCTGAAGGAATTAGCTCGCAACAGTCCTACGTACTTTCACCAGCACATAGGTGTTGTATTCGACAACATTC
TAATACCTCTACGTGATCCTCGGGTCCATATCCGCGAAGGGACAGCAGAATTATTGGCAGCTTGCCTTGAAATAG
TCACCACTCGAGAGCGTCAAACGAGGAGTCCATATCTTTCTAAAATGCTGCAGGATGCTCATCAAGGCCTAAAAG
GAAGCTCGATGGACATTGTGCACGGTTCACTGTTGACATATCGCGAGTTATTACTCCACGCTGGAATGGTAAGTT
CTTAGGTTAATTTGAGATGTCAGGGCTCTGACGGCGCGTTTCATAAAAGTTCATGAAGGAGAATTACCTCGATAT
TGCTGAACAGATTCTCCGGTACAAGTCACATCGAGATCCCCTCATCCGAAAAATGGTGATAACAATGATTCCATC
CTTGGCTGTTTACGACACACAGACCTTCACCGAACATTTCCTACACAAAGCGATGGGTCACCTTTTGACGCAGCT
GGAAAAACCAGCTGAACGGAATTACGGTAAGAACGAATCATTAACTCTTGGAACTGCTTTGATTGTAATACTGCT
AAATTTTCAGCGTTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTAGACTCT
ATTATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGGTGAGTGTATATCGTTTTACGGAACCCTGCAGAGTTC
TAAATACATATCTGTCAAGACGCAAGAATGCTCCGAACGAAGAGCCGCTCTTCCAATGTATGGGGATGTTGGCGG
CAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTCATGATGAGCTGCGGGTTGAGTGAGC
CATTGAAGAATGCGCTTGCTATCATTGCGAAACACATACCTCCTCTACTCAAAACAATTCAAGGTGGGCGATTTT
GTGATTAGTCTCGAAAACTACTCACCAATTTCGAGAAGATCGATTACTGGATCTCCTATCACAGGTTCTAAGTGG
ACAACCGTACAAGCCTTTGGGTGCTCCTCCGCTTGCCAGCAGACAAGATGGTTCTGGTATCATGTCCAATGTTCC
TCCTCAAGTGAGTGCTTCTGTGTGTCCTAAGCTTGTGGTTTAATGTGACTGCGAGAAGGCATCTCACGACAAAAG
TCCTGAGTTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAGTGGTCAGTCCTGCAAACTTCCTCA
CGTAGCTTGATGTTGAAATAGGAAATTACCATTATCAGGGCATGTACTCAATGAATTTGTACGGAATTGCGCCGT
TCCTTATCTCGAAGATGACCAACCCGAAGTTCGCCGAGCAGCTGCGTTGACTTGTTGTCGGCTTTTTGTTCGCGA
TCCCATCTGCTATCAGTCAAGCAGCCATGCCATCGAGATTATCAGCGATGTACTAGACAAGCTGTTAACAGTGGG
CATCGCTGATCCTGGTATATCTATTAATTTTCCACTATTGAGCCATCCACTAAGTTTCCATTTTTCCCTTGTAGA
TCCATCAATTCGGCAGACGGTGCTTGGTGCTCTACATGAAAAGTTTGACAAACACTTGGCACAGGCAGAGAATGT
TCGCTCACTGTTCATCGCTTTAAATGATGAGGTATTTGAAAACCGCATGATTGCGGTGGGTCTTATTGGGCGGCT
AGCAAGACACAATCCTGCCTATGTGATGCCATCCCTGCGTAAAGCGTTGATTCAGCTCCTGACTGAGCTTGAATA
CTCAACTGTACTGTATGTCTCTTTCGTATCTGAGCACTTTGGTACACTCATTGACCATTCAAAGTCGAAGTCGCG
AGGAATGCACGCGGTTATTGACGCTTCTAGTAAGCTGTACGCAGCGGTTAATCAAACCCTACGCCCTACCCATGC
TTCGGGTCTTAATACAAAAAGCGAATGACGTCAACCCGACAGTTTCTGCCAATGTCCTTATGTGTTTAGGGGAGC
TCGTTTGTATTGCTGGGGAAGACGCGCTTCCCCATGTACCTGACTTGATGGCAGTTATCATTGCAAGGCTTTCGG
ATCCATCGATCAGTAAGAGGGATGCTGCACTCCGTGCTTTGGGTCAATTATGCTCTAGCACGGGCTATGTCATCA
CTCCCTTAGTGGAGTATCCGCAGTTGGTACCGCTACTGTCCAGAATTCTCAAATCTGATGGAGCCAAAAATATGA
GACGGGAAGTAGTGAAGGTGTTGGGCATTCTTGGTGCACTGGACCCATATAGGCGGAAGGTAAGGAGTCTTCCTC
AGAGTTATGATACAATTCATTCATGGTACAATTAGACGCGACCTGATGACGAGGCCGTGAGCGAGAAGGCCGTCA
CTGCCGTTATACAGGTACCGGTGGCGCAGTTCAACGCAGTCTCCGGAGCCGATGATTACTTTCAAACCGTGGTTA
TCAACTCCCTTCTCGTCATTCTCAAGGACCAGGCTTTGAGTAGCCATCATCATACCGTGATTGAAGCCGTGATGT
CTATATTCAAGACCCAGGGTTTGAAATGCGTCACTTTCTTACCACAGGTACGTTAATTAACGGCTTTTGAATCAC
GAATATTCGTATCCTTAGGCATGGTTATTCCTAGATCATTCCGGCCTTCGCGTCAGTTACTCGGACATCTTCTGT
CGCTCGGCTGCAGGAGTTCCATCTACAACAACTCGCTATTTTGGTTGAGATCATCAAGCAACATGTCCGAAATTA
TATGCCGGAAATCTTTGCCCTTGTTACTGAACTTTGGGAAAATTCAGCCCTTCAGCTCCCTATCGTGGCTTTGAT
AGAAGCTTTGGGTAAAGCGCTTGACGCGGAGTTCAAACCATTCCTTCCTACCATTCTGCCCCTCATTCTCAAAGT
CTTTGAAGGAGGTCCTCCTGATGACAAACGAAGTTCTGTCCAGATCAAGGTCTTCGATGCGTTCCTTACCTTTGG
TTCGAACATCGAGGAATACCTTCATTTGGTGATACCGATTATTGTGAAGACATATGAGCGCGATGGTAGTACTCA
GCTTCGCAAGAAAGCTATTCAAACAATTCATGGGTTGTCACGAAGAGTCAACTTTTCGGATCATGCGTCTCGCAT
TATTCATCCTTTGGCTCGGGTGCTGGATAATTCCAATACGGAGCTCAGAATTTCGGTCATGGAAACGTTGTGTTC
TTTAATGATGCAACTTGGAGCCGATTTTGCCATTTTTGTTCCTACTATCAATAAGGTCATATTTTCCGTTCTCGC
ATAACCTTCACTTTGACTAATTCTATAACAGAGTATCATGCGAAACAAGGTTGCTCCTCATCACGTTTATGAGAA
CATGATTAGCAAACTTCTGAATGGTGAACCACTACCTCAGGATATGGCCCTACAGGATTCGCTGTGAGTGTGCAC
TCAAGTCAAGCAATATCGCGTTCTTAATTTGTTTCCCAAGTGAACCAAACAAAACTCCAGAATTTACAGCCCCTG
CCGAAGCGTCCAAGATGGCCGTTAACCAACAGCATCTTAAGCAAGCGTGGGACGTGTCTCAGATTGCTACTCGAG
AAGACTGGTTTGAGTGGATTCACCGGCTTAGTGTTGAGTTTATGAAGGAATCTCCATCCCATGCCCTCCGAGCGT
GTATGGGTCTCGTTGATATACACCCTCCCCTTGCGAAAGAACTTTTCAACGCCGCTTTTCTCTCTTGCTGGAGCG
AGCTGTATGACCAGTATCAGGTTCGTCTCTCAATTGTAACCACCCTTTTTGTTACTCAACGTACACTAGGAGGAC
CTGGTTCGCTCTGTCGAACATGCAATTACATCAAACGACGCACCCCCAGAGCTTATACATCGTCTACTGAACCTG
GCGGAGTTCATGGAACATGAAGAAAAACCACTTCCTATTGAGCATCGAACCCTCGGCGAGTATGCGATGAAGTAC
ATGGCATACGCTAAAGCTCTTCACTACAAGGAACTGGAGTACTTCTCGGAAGCTTCTCCTGCTGTCGTTGAGTCT
CTCATATCCATCAACACACGCCTACAACAACATGACGCCGCGTGGGGTACTCTCATGACCGCTAAAGAACAATAT
AACGTGACCGAACATGAAGAGTGGTATGAGAGGTTGGGCCGCTGGCAAGAGGCGCTAGTTGCATACGAGAAAGCG
GCCGAAAATGACCCGAGTGATCTCGAAGTTCAATTTGGACGGATGAAATGTCTTCACGCACTTGGGGAATGGGAT
CAATTAGCGACACGCGTCAATGAGCACTGGGCCACTGCCTCCCATGATGATCGTCGAGAGATTGCACCAATGGCG
GCGGCAGCGGCTTGGTCGCTCAATGCGTGGGATGACATGGAAGACTACATCAACACTATGAAGTCCGACTCTCCA
GATCGAGCGTTCTACAGAGCTATTCTTTTCGTTCAGCAAAATCAATTTCCCAAGGCTTTGTCACAAATAGCGAAG
GCCCGTGACTTGCTAGACCCCGAACTCAGTTCTTTCGTTGGAGATAGTTATGGGCGACTTTATGGGTGGGTTATA
TGCAATGGTTCTTCCACTTCTCACTCATAATAGAGTGCTAGTGTTATGGTTCGCGCTCAGATGCTATCAGAGCTG
GAGGAAATTATTGCCTTCAAGCAGTATGCGGATCAGCCCGAAAGGCAGCTAACGATGCGGAAGACGTGGCTCAAG
AGGTTTGGTGCCACATCCTTACGAGTCTAAAAAGAGTTAATTCCCCTCCAGGTTGCAGGGCTGCCAGCCAGACGT
TGAAATATGGCAGAGGATCCTGCAAGTGCGAACGCTGGTTTTGAACCCGGAAGACGACCCAGTCATGTGGATCAA
ATTTGCTAATCTGTGTCGAAAGAACGATCGCATGCCGCTGGCCGAGAAAACCATCAATTCGTTATTGTCGCCAGA
GAGGGTAAGACTTTTCGATAGTTGTGGGCGTCAACATGCTGATTAGCTTCAGTTTCGGCTCCAAGATCATCATAC
CAAGGCGACCCCGAATGTTGTATATGCTCACCTGAAGTATATGTGGGCTCAGTCCAAGGAGTCCAGACATGAGAG
TCTGGAGTTTCTTCGTCGATTCACTGAAGAGCTCGCGCACGACCTAAGCCAGGAAGTGAGCGAAAATTCGCACCA
TCGGCTTGCCACCCCGCTTTCGAAGCAGAAGCTGACGGAATTATCAAAGCTCCTTGCGCGATGTTATTATAAGCA
AGGTGAATGGCAGACTCAGCTCGGTGTAAATTGGGGCACCGTGAGTTTTTTTTTGTTTTTGTTTTTTCATAGCTC
ACCGCGGCTCATGATCGAGTTCAGAGGAACACGGAGGAAATTTTGCATGCTTATTACCTAGCTACACACTACGAC
ACTGTGTGGTACAAAGCCTGGCATACTTGGGCTCTGACTAATTTCGAAGTTGTAAGTGAACTGGAGGCTCAAGCT
GAAGGTCGGACAGTCGATATACCGGGAGAAGGCATTGCCGCACATGTCGTTCAAGCGGTTGAAGGTATGTCATAT
CGAGTCTATGTGAGAATATGACTTAGACTTGTTGTGAACTTGCGCAGGGTTTTTCCGTTCCATTGCCCTGAAAAA
TGTTGACGCGCTTCAAGATATACTGCGGCTACTTACTCTCTGGTTCAAGTTTGGTGCACATGACGATGTCAGTGA
CGCGATGGCCAATGGATTTTCTACCGTAGAAGTTGATACATGGCTAGAAGTTGTTCCGCAGGTAAGTTGCAAGCT
TCCATCTTCATGAACGCCACTTGATGAGGCTTAGATCATTGCCCGTATCCAAACGCCATCAATCAACATACGTCG
CACCATCAGCAATCTTCTCACCGACATCGGGAAGCATCATCCACAGGCACTCATATATCCCCTGACTGTTGCGTC
TAAATCTTCAAGCGTCGCTCGAATGAAAGCTGCTCAGGCTATCATGGATCGGATGGGCGAACACAGCCCATTGAT
CGTGACTCAGGTTGGTACCCGCCATTTCCTTTCAGGAAGAATAAGTAGTTGATCACGGCGTCAGGCACAATCGGT
CAGCCAAGAGCTTATTCGCGTAGCTATTCTATGGCATGAATTGTGGCATGAAGGTTTGGAGGAAGCGTCGAGGCT
GTATTTCACAGAAAAGAACCCAGATGGGATGATAGCTGCCCTGGAACCGTTGCATGACCTTTTAGAAAAGGTGAA
TAGTCTTCGAAATAACGTTTTTCCTACTGAGTCGCCTGTCTAGGGACCACGAACTGCCCGCGAAACTTCATTTGT
TCAAGCCTTTGGACGTGAGCTTCATGAAGCCCGCGAAGCCTGTCGCCGATTCCGTATCTATGGAGAAACCGCAGA
GTTAGACAGAGCCTGGGACATATACTACGGGGTCAGTGGTTTGAACGTATTTGATGAACTTCTGGTTGACACGGG
ACAATGTGCCTCAGGTATTCAAGCGCGTCGAGAAGCAGTTGCCCCAACTTACCTCTCTCGACTTGCAATATGTAT
CACCTCTGCTTCTTAAAGCTCGGAATCTTGAACTAGCCGTCCCGGGAACTTACCAGAGCGGCAGGGCTATCATTC
GGATACAGAGTTTTGCAACGAAACTAACAGTCATTGCATCCAAACAGAGACCACGACGACTGTGTCTGAGGGGTG
AGGATGGACGCGATTATCAATATATTCTTAAAGGTCACGAAGATCTCCGTCAAGATGAACGAGTCATGCAGCTGT
TTGGCTTGGTCAACACATTGCTCTCCGTCGACACGAATAGCTTTAAACGTCGCCTCCACATTCAGCGTTATCCCG
TTATCCCGCTCGCTCCGAATGCGGGTTTGCTAGGCTGGGTGCAAGACAGTGATACCTTACATGTCCTCATCCGTG
ACTACCGTGATTCAAGGAAGGTCCTCCTCAACATTGAGTATCGACTGATGCTCCAGGTCCGTTTGGTCTCTGTTG
TTGTAGGCGGCCAGCTCACCGATTCTAGATGGCTCCCGATTACGAGAATCTCACCTTGTTGCAAAAGGTCGAAGT
TTTCGAGTATGCACTGGAGAATACCACTGGTCAGGATTTATACCGTGTATTATGGCTCAAGAGTACCAACTCTGA
GCATTGGTTGGAGCGCCGAGCAACATACACCCGGTCACTTGCTGTGAACAGTATGGTTGGGCATATACTCGGATT
GGGCGATCGACATCCTTCCAATCTCTTGTTAGAGCGAAGTACAGGAAAAGTTGTTCATATCGACTTCGGTGATTG
TTTCGAAGTCGCAATGCACCGCGAGAAGTTCCCAGAGAAAGTACCATTCCGGCTGACGAGGATGTTGACCCATGC
TATGGAGGTGCGAATCACTTGCATGGTGATCCAGCCTTCCATTTACATTTATACTAGGTCAGCGGCATCGAGGGA
AGCTTCAAGAATACTTGCGAAATTACCATGACAGTACTGCGGGATAATAAAGATTCCCTTCTGGCTGTCCTGGAG
GCGTTCGTATACGATCCTTTGATCAATTGGCGATTGATGCAGACCGAAGTTGAAGGCCGACGCAATGAAGGTGGA
GAAATTTCTTATCACCGGCTAACCTATCTGACCAATATCTGACAGTGGATCCTGATCGCGCTGCTGAGCTAGCGC
GCGTGGCTGCGCATCCTCAAGGCCCCCAACGGAAGCTTAAAGCGAATGAGAACGATATTTTCAATGGTACGCTCC
TACTCTCCGTTCAGAACACGTTCACTGATACTTTTTTTACTCCTGTAGAAACCCAAGGAGAACCCGGTGCCCAAG
AAATACGTAATGAACGAGCACTTTTCGTTTTCCACCGCGTCCAGCATAAGCTTACTGGTCCGTTCTTTCTGGAAT
TCCGATGCCAACTTGACGCTGACTCCACCACCATAGGCCGTGACTTCAACCCGGAAATTACTTTGTCAATTCGTG
ATCAAGTTGAGAAACTCATTGATTCAGCGACCGCCCTTGAAAATCTCTGCCAATGCTTCTCAGGTTGGTGCGCGT
TCTGGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail