Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091840
Gene name
Locationscaffold_6:952450..954000
Strand-
Gene length (bp)1550
Transcript length (bp)1341
Coding sequence length (bp)1341
Protein length (aa) 447

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09320 DUF1977 Domain of unknown function (DUF1977) 3.0E-27 322 440
PF00226 DnaJ DnaJ domain 1.1E-23 140 201

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 1 444 1.0E-65
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 1 443 9.0E-53
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 1 443 3.0E-51
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 1 399 4.0E-51
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 1 399 3.0E-49
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13633|YNF5_SCHPO Uncharacterized J domain-containing protein C17A3.05c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pi041 PE=1 SV=1 1 444 1.0E-65
sp|Q7ZXQ8|DJB14_XENLA DnaJ homolog subfamily B member 14 OS=Xenopus laevis GN=dnajb14 PE=2 SV=1 1 443 9.0E-53
sp|Q28I38|DJB14_XENTR DnaJ homolog subfamily B member 14 OS=Xenopus tropicalis GN=dnajb14 PE=2 SV=1 1 443 3.0E-51
sp|Q58DR2|DJB12_BOVIN DnaJ homolog subfamily B member 12 OS=Bos taurus GN=DNAJB12 PE=2 SV=1 1 399 4.0E-51
sp|Q9NXW2|DJB12_HUMAN DnaJ homolog subfamily B member 12 OS=Homo sapiens GN=DNAJB12 PE=1 SV=4 1 399 3.0E-49
sp|Q9QYI4|DJB12_MOUSE DnaJ homolog subfamily B member 12 OS=Mus musculus GN=Dnajb12 PE=1 SV=2 1 399 7.0E-49
sp|Q8TBM8|DJB14_HUMAN DnaJ homolog subfamily B member 14 OS=Homo sapiens GN=DNAJB14 PE=1 SV=1 1 443 4.0E-47
sp|Q5R6H3|DJB14_PONAB DnaJ homolog subfamily B member 14 OS=Pongo abelii GN=DNAJB14 PE=2 SV=1 1 443 8.0E-46
sp|Q149L6|DJB14_MOUSE DnaJ homolog subfamily B member 14 OS=Mus musculus GN=Dnajb14 PE=2 SV=1 1 443 2.0E-45
sp|Q0IIE8|DJB14_BOVIN DnaJ homolog subfamily B member 14 OS=Bos taurus GN=DNAJB14 PE=2 SV=1 1 446 1.0E-44
sp|Q5EA26|DJC18_BOVIN DnaJ homolog subfamily C member 18 OS=Bos taurus GN=DNAJC18 PE=2 SV=1 95 443 7.0E-34
sp|Q9H819|DJC18_HUMAN DnaJ homolog subfamily C member 18 OS=Homo sapiens GN=DNAJC18 PE=2 SV=1 122 443 2.0E-32
sp|Q9CZJ9|DJC18_MOUSE DnaJ homolog subfamily C member 18 OS=Mus musculus GN=Dnajc18 PE=2 SV=1 122 443 2.0E-31
sp|Q95KD5|DJC18_MACFA DnaJ homolog subfamily C member 18 OS=Macaca fascicularis GN=DNAJC18 PE=2 SV=1 122 443 3.0E-31
sp|P48353|HLJ1_YEAST Protein HLJ1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=HLJ1 PE=1 SV=1 122 282 7.0E-31
sp|Q9FH28|DNJ49_ARATH Chaperone protein dnaJ 49 OS=Arabidopsis thaliana GN=ATJ49 PE=2 SV=2 1 247 1.0E-22
sp|Q9LCQ4|DNAJ_BRECH Chaperone protein DnaJ OS=Brevibacillus choshinensis GN=dnaJ PE=3 SV=1 140 249 1.0E-19
sp|Q8NHS0|DNJB8_HUMAN DnaJ homolog subfamily B member 8 OS=Homo sapiens GN=DNAJB8 PE=1 SV=1 138 248 6.0E-19
sp|Q9UXR9|DNAJ_METTE Chaperone protein DnaJ OS=Methanosarcina thermophila GN=dnaJ PE=3 SV=1 140 223 3.0E-18
sp|Q8EUM4|DNAJ_MYCPE Chaperone protein DnaJ OS=Mycoplasma penetrans (strain HF-2) GN=dnaJ PE=3 SV=1 140 318 4.0E-18
sp|Q9QYI7|DNJB8_MOUSE DnaJ homolog subfamily B member 8 OS=Mus musculus GN=Dnajb8 PE=2 SV=1 138 248 6.0E-18
sp|P50027|DNAJH_SYNY3 DnAJ-like protein slr0093 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=slr0093 PE=3 SV=1 140 287 3.0E-17
sp|P0CW06|DNAJ_METMZ Chaperone protein DnaJ OS=Methanosarcina mazei GN=dnaJ PE=3 SV=1 140 204 3.0E-17
sp|P0CW07|DNAJ_METMA Chaperone protein DnaJ OS=Methanosarcina mazei (strain ATCC BAA-159 / DSM 3647 / Goe1 / Go1 / JCM 11833 / OCM 88) GN=dnaJ PE=3 SV=1 140 204 3.0E-17
sp|P75354|DNAJM_MYCPN DnaJ-like protein MG200 homolog OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=MPN_119 PE=3 SV=1 140 234 4.0E-17
sp|Q45552|DNAJ_GEOSE Chaperone protein DnaJ OS=Geobacillus stearothermophilus GN=dnaJ PE=3 SV=1 140 249 1.0E-16
sp|B2G6W4|DNAJ_LACRJ Chaperone protein DnaJ OS=Lactobacillus reuteri (strain JCM 1112) GN=dnaJ PE=3 SV=1 140 233 1.0E-16
sp|A5VJE8|DNAJ_LACRD Chaperone protein DnaJ OS=Lactobacillus reuteri (strain DSM 20016) GN=dnaJ PE=3 SV=1 140 233 1.0E-16
sp|Q6A997|DNAJ1_PROAC Chaperone protein DnaJ 1 OS=Propionibacterium acnes (strain KPA171202 / DSM 16379) GN=dnaJ1 PE=3 SV=1 140 211 2.0E-16
sp|Q54ED3|DNJA1_DICDI DnaJ homolog subfamily A member 1 homolog OS=Dictyostelium discoideum GN=dnaja1 PE=3 SV=1 137 206 2.0E-16
sp|B0JW23|DNAJ_MICAN Chaperone protein DnaJ OS=Microcystis aeruginosa (strain NIES-843) GN=dnaJ PE=3 SV=1 139 252 4.0E-16
sp|Q9D832|DNJB4_MOUSE DnaJ homolog subfamily B member 4 OS=Mus musculus GN=Dnajb4 PE=1 SV=1 140 248 4.0E-16
sp|Q5FWN8|DNJ6A_XENLA DnaJ homolog subfamily B member 6-A OS=Xenopus laevis GN=dnajb6-a PE=2 SV=1 138 248 6.0E-16
sp|B2J3J3|DNAJ_NOSP7 Chaperone protein DnaJ OS=Nostoc punctiforme (strain ATCC 29133 / PCC 73102) GN=dnaJ PE=3 SV=1 140 253 7.0E-16
sp|C5D4U0|DNAJ_GEOSW Chaperone protein DnaJ OS=Geobacillus sp. (strain WCH70) GN=dnaJ PE=3 SV=1 140 249 8.0E-16
sp|Q5R8J8|DNJB4_PONAB DnaJ homolog subfamily B member 4 OS=Pongo abelii GN=DNAJB4 PE=2 SV=1 140 248 9.0E-16
sp|Q9UDY4|DNJB4_HUMAN DnaJ homolog subfamily B member 4 OS=Homo sapiens GN=DNAJB4 PE=1 SV=1 140 248 9.0E-16
sp|Q6G553|DNAJ_BARHE Chaperone protein DnaJ OS=Bartonella henselae (strain ATCC 49882 / DSM 28221 / Houston 1) GN=dnaJ PE=3 SV=1 139 252 1.0E-15
sp|Q2KIT4|DNJB4_BOVIN DnaJ homolog subfamily B member 4 OS=Bos taurus GN=DNAJB4 PE=2 SV=1 140 248 1.0E-15
sp|Q6G1F8|DNAJ_BARQU Chaperone protein DnaJ OS=Bartonella quintana (strain Toulouse) GN=dnaJ PE=3 SV=1 139 244 1.0E-15
sp|O25890|DNAJ_HELPY Chaperone protein DnaJ OS=Helicobacter pylori (strain ATCC 700392 / 26695) GN=dnaJ PE=3 SV=1 141 228 2.0E-15
sp|B3WEQ6|DNAJ_LACCB Chaperone protein DnaJ OS=Lactobacillus casei (strain BL23) GN=dnaJ PE=3 SV=1 140 204 2.0E-15
sp|Q038N5|DNAJ_LACC3 Chaperone protein DnaJ OS=Lactobacillus casei (strain ATCC 334) GN=dnaJ PE=3 SV=1 140 204 2.0E-15
sp|Q6L0S6|DNAJ_PICTO Chaperone protein DnaJ OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=dnaJ PE=3 SV=1 140 251 2.0E-15
sp|Q80Y75|DJB13_MOUSE DnaJ homolog subfamily B member 13 OS=Mus musculus GN=Dnajb13 PE=1 SV=1 140 248 3.0E-15
sp|Q3MG81|DNAJ_ANAVT Chaperone protein DnaJ OS=Anabaena variabilis (strain ATCC 29413 / PCC 7937) GN=dnaJ PE=3 SV=1 140 216 3.0E-15
sp|Q9QYI5|DNJB2_MOUSE DnaJ homolog subfamily B member 2 OS=Mus musculus GN=Dnajb2 PE=1 SV=2 138 249 3.0E-15
sp|Q8YUA5|DNAJ_NOSS1 Chaperone protein DnaJ OS=Nostoc sp. (strain PCC 7120 / UTEX 2576) GN=dnaJ PE=3 SV=1 140 216 3.0E-15
sp|O89114|DNJB5_MOUSE DnaJ homolog subfamily B member 5 OS=Mus musculus GN=Dnajb5 PE=2 SV=1 140 204 3.0E-15
sp|O06431|DNAJ_NITEU Chaperone protein DnaJ OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=dnaJ PE=3 SV=2 139 204 4.0E-15
sp|C4K3I5|DNAJ_HAMD5 Chaperone protein DnaJ OS=Hamiltonella defensa subsp. Acyrthosiphon pisum (strain 5AT) GN=dnaJ PE=3 SV=1 140 248 4.0E-15
sp|Q8WW22|DNJA4_HUMAN DnaJ homolog subfamily A member 4 OS=Homo sapiens GN=DNAJA4 PE=1 SV=1 137 249 4.0E-15
sp|Q5M6D0|DNAJ_STRT2 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain ATCC BAA-250 / LMG 18311) GN=dnaJ PE=3 SV=1 139 249 4.0E-15
sp|Q5M1T7|DNAJ_STRT1 Chaperone protein DnaJ OS=Streptococcus thermophilus (strain CNRZ 1066) GN=dnaJ PE=3 SV=1 139 249 4.0E-15
sp|Q82BY4|DNAJ2_STRAW Chaperone protein DnaJ 2 OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=dnaJ2 PE=3 SV=1 139 207 4.0E-15
sp|O75953|DNJB5_HUMAN DnaJ homolog subfamily B member 5 OS=Homo sapiens GN=DNAJB5 PE=1 SV=1 140 204 5.0E-15
sp|Q9JMC3|DNJA4_MOUSE DnaJ homolog subfamily A member 4 OS=Mus musculus GN=Dnaja4 PE=1 SV=1 137 249 5.0E-15
sp|Q5BIP8|DNJB5_BOVIN DnaJ homolog subfamily B member 5 OS=Bos taurus GN=DNAJB5 PE=2 SV=1 140 204 5.0E-15
sp|Q9RDD7|DNAJ2_STRCO Chaperone protein DnaJ 2 OS=Streptomyces coelicolor (strain ATCC BAA-471 / A3(2) / M145) GN=dnaJ2 PE=3 SV=1 139 207 5.0E-15
sp|O52164|DNAJ2_STRAL Chaperone protein DnaJ 2 OS=Streptomyces albus G GN=dnaJ2 PE=3 SV=1 139 207 6.0E-15
sp|Q8DKR7|DNAJ_THEEB Chaperone protein DnaJ OS=Thermosynechococcus elongatus (strain BP-1) GN=dnaJ PE=3 SV=2 140 248 6.0E-15
sp|P25686|DNJB2_HUMAN DnaJ homolog subfamily B member 2 OS=Homo sapiens GN=DNAJB2 PE=1 SV=3 138 249 7.0E-15
sp|Q2YT48|DNAJ_STAAB Chaperone protein DnaJ OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|P63972|DNAJ_STAAW Chaperone protein DnaJ OS=Staphylococcus aureus (strain MW2) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A8Z4B8|DNAJ_STAAT Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|Q6G8Y8|DNAJ_STAAS Chaperone protein DnaJ OS=Staphylococcus aureus (strain MSSA476) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|P63971|DNAJ_STAAN Chaperone protein DnaJ OS=Staphylococcus aureus (strain N315) GN=dnaJ PE=1 SV=1 140 206 7.0E-15
sp|P63970|DNAJ_STAAM Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A6QHC2|DNAJ_STAAE Chaperone protein DnaJ OS=Staphylococcus aureus (strain Newman) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|Q5HFI1|DNAJ_STAAC Chaperone protein DnaJ OS=Staphylococcus aureus (strain COL) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A5ITA7|DNAJ_STAA9 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH9) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|Q2FXZ3|DNAJ_STAA8 Chaperone protein DnaJ OS=Staphylococcus aureus (strain NCTC 8325) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|Q2FGE4|DNAJ_STAA3 Chaperone protein DnaJ OS=Staphylococcus aureus (strain USA300) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A6U251|DNAJ_STAA2 Chaperone protein DnaJ OS=Staphylococcus aureus (strain JH1) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A7X2Y0|DNAJ_STAA1 Chaperone protein DnaJ OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=dnaJ PE=3 SV=1 140 206 7.0E-15
sp|A5UYW4|DNAJ_ROSS1 Chaperone protein DnaJ OS=Roseiflexus sp. (strain RS-1) GN=dnaJ PE=3 SV=1 140 252 7.0E-15
sp|Q9KWS6|DNAJ_GEOTM Chaperone protein DnaJ OS=Geobacillus thermoglucosidasius GN=dnaJ PE=3 SV=1 140 249 8.0E-15
sp|Q6GGC1|DNAJ_STAAR Chaperone protein DnaJ OS=Staphylococcus aureus (strain MRSA252) GN=dnaJ PE=3 SV=1 140 206 8.0E-15
sp|A0Q1R3|DNAJ_CLONN Chaperone protein DnaJ OS=Clostridium novyi (strain NT) GN=dnaJ PE=3 SV=1 140 250 8.0E-15
sp|P0DJM1|DNAJ_LISMO Chaperone protein DnaJ OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=dnaJ PE=3 SV=1 140 249 9.0E-15
sp|G2K045|DNAJ_LISM4 Chaperone protein DnaJ OS=Listeria monocytogenes serotype 1/2a (strain 10403S) GN=dnaJ PE=3 SV=1 140 249 9.0E-15
sp|Q24133|DNAJ1_DROME DnaJ protein homolog 1 OS=Drosophila melanogaster GN=DnaJ-1 PE=1 SV=3 140 279 9.0E-15
sp|B1XQF6|DNAJ_SYNP2 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27264 / PCC 7002 / PR-6) GN=dnaJ PE=3 SV=1 140 202 9.0E-15
sp|A6QBG7|DNAJ_SULNB Chaperone protein DnaJ OS=Sulfurovum sp. (strain NBC37-1) GN=dnaJ PE=3 SV=1 140 204 1.0E-14
sp|A7NS65|DNAJ_ROSCS Chaperone protein DnaJ OS=Roseiflexus castenholzii (strain DSM 13941 / HLO8) GN=dnaJ PE=3 SV=1 140 252 1.0E-14
sp|Q6PGY5|DJC21_DANRE DnaJ homolog subfamily C member 21 OS=Danio rerio GN=dnajc21 PE=2 SV=1 141 201 1.0E-14
sp|B8DE39|DNAJ_LISMH Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4a (strain HCC23) GN=dnaJ PE=3 SV=1 140 249 1.0E-14
sp|Q92BN9|DNAJ_LISIN Chaperone protein DnaJ OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=dnaJ PE=3 SV=1 140 249 1.0E-14
sp|Q9QYJ3|DNJB1_MOUSE DnaJ homolog subfamily B member 1 OS=Mus musculus GN=Dnajb1 PE=1 SV=3 140 204 1.0E-14
sp|Q7M9T3|DNAJ_WOLSU Chaperone protein DnaJ OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=dnaJ PE=3 SV=1 140 250 1.0E-14
sp|Q71ZJ8|DNAJ_LISMF Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain F2365) GN=dnaJ PE=3 SV=1 140 249 1.0E-14
sp|C1KVB9|DNAJ_LISMC Chaperone protein DnaJ OS=Listeria monocytogenes serotype 4b (strain CLIP80459) GN=dnaJ PE=3 SV=1 140 249 1.0E-14
sp|Q892R1|DNAJ_CLOTE Chaperone protein DnaJ OS=Clostridium tetani (strain Massachusetts / E88) GN=dnaJ PE=3 SV=1 140 222 2.0E-14
sp|Q5E954|DNJA1_BOVIN DnaJ homolog subfamily A member 1 OS=Bos taurus GN=DNAJA1 PE=2 SV=2 137 249 2.0E-14
sp|Q5NVI9|DNJA1_PONAB DnaJ homolog subfamily A member 1 OS=Pongo abelii GN=DNAJA1 PE=2 SV=1 137 249 2.0E-14
sp|Q95JF4|DNAJ1_CHLAE DnaJ homolog subfamily A member 1 OS=Chlorocebus aethiops GN=DNAJA1 PE=2 SV=1 137 249 2.0E-14
sp|P31689|DNJA1_HUMAN DnaJ homolog subfamily A member 1 OS=Homo sapiens GN=DNAJA1 PE=1 SV=2 137 249 2.0E-14
sp|B2IBR5|DNAJ_BEII9 Chaperone protein DnaJ OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=dnaJ PE=3 SV=1 140 251 2.0E-14
sp|Q5HTK3|DNAJ_CAMJR Chaperone protein DnaJ OS=Campylobacter jejuni (strain RM1221) GN=dnaJ PE=3 SV=1 141 226 2.0E-14
sp|O85213|DNAJ_CAMJE Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=dnaJ PE=3 SV=2 141 226 2.0E-14
sp|P30725|DNAJ_CLOAB Chaperone protein DnaJ OS=Clostridium acetobutylicum (strain ATCC 824 / DSM 792 / JCM 1419 / LMG 5710 / VKM B-1787) GN=dnaJ PE=2 SV=2 140 204 2.0E-14
sp|Q3MI00|DNJB1_BOVIN DnaJ homolog subfamily B member 1 OS=Bos taurus GN=DNAJB1 PE=2 SV=3 140 204 2.0E-14
sp|Q03FR6|DNAJ_PEDPA Chaperone protein DnaJ OS=Pediococcus pentosaceus (strain ATCC 25745 / 183-1w) GN=dnaJ PE=3 SV=1 140 250 2.0E-14
sp|P25685|DNJB1_HUMAN DnaJ homolog subfamily B member 1 OS=Homo sapiens GN=DNAJB1 PE=1 SV=4 140 204 2.0E-14
sp|Q6MNG0|DNAJ_BDEBA Chaperone protein DnaJ OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=dnaJ PE=3 SV=1 140 206 2.0E-14
sp|Q38W94|DNAJ_LACSS Chaperone protein DnaJ OS=Lactobacillus sakei subsp. sakei (strain 23K) GN=dnaJ PE=3 SV=1 140 204 2.0E-14
sp|O87778|DNAJ_LACSK Chaperone protein DnaJ OS=Lactobacillus sakei GN=dnaJ PE=2 SV=1 140 204 3.0E-14
sp|B7KEJ8|DNAJ_CYAP7 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7424) GN=dnaJ PE=3 SV=1 140 251 3.0E-14
sp|A7H2C0|DNAJ_CAMJD Chaperone protein DnaJ OS=Campylobacter jejuni subsp. doylei (strain ATCC BAA-1458 / RM4099 / 269.97) GN=dnaJ PE=3 SV=1 141 206 3.0E-14
sp|A0AIS3|DNAJ_LISW6 Chaperone protein DnaJ OS=Listeria welshimeri serovar 6b (strain ATCC 35897 / DSM 20650 / SLCC5334) GN=dnaJ PE=3 SV=1 140 249 3.0E-14
sp|Q114R3|DNAJ_TRIEI Chaperone protein DnaJ OS=Trichodesmium erythraeum (strain IMS101) GN=dnaJ PE=3 SV=1 140 255 3.0E-14
sp|B9DNJ9|DNAJ_STACT Chaperone protein DnaJ OS=Staphylococcus carnosus (strain TM300) GN=dnaJ PE=3 SV=1 140 206 3.0E-14
sp|P47442|DNAJM_MYCGE DnaJ-like protein MG200 OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=MG200 PE=1 SV=1 140 240 3.0E-14
sp|B1HUD0|DNAJ_LYSSC Chaperone protein DnaJ OS=Lysinibacillus sphaericus (strain C3-41) GN=dnaJ PE=3 SV=1 140 249 4.0E-14
sp|A5UF67|DNAJ_HAEIG Chaperone protein DnaJ OS=Haemophilus influenzae (strain PittGG) GN=dnaJ PE=3 SV=1 140 204 4.0E-14
sp|B8HLD2|DNAJ_CYAP4 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 7425 / ATCC 29141) GN=dnaJ PE=3 SV=1 140 204 4.0E-14
sp|A6Q486|DNAJ_NITSB Chaperone protein DnaJ OS=Nitratiruptor sp. (strain SB155-2) GN=dnaJ PE=3 SV=1 140 204 4.0E-14
sp|Q97BG9|DNAJ_THEVO Chaperone protein DnaJ OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=dnaJ PE=3 SV=1 140 251 4.0E-14
sp|P45555|DNAJ_STAAU Chaperone protein DnaJ OS=Staphylococcus aureus GN=dnaJ PE=3 SV=1 140 206 4.0E-14
sp|A8FMW6|DNAJ_CAMJ8 Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=dnaJ PE=3 SV=1 141 226 5.0E-14
sp|B2V2I6|DNAJ_CLOBA Chaperone protein DnaJ OS=Clostridium botulinum (strain Alaska E43 / Type E3) GN=dnaJ PE=3 SV=1 140 204 5.0E-14
sp|P63036|DNJA1_RAT DnaJ homolog subfamily A member 1 OS=Rattus norvegicus GN=Dnaja1 PE=1 SV=1 137 249 5.0E-14
sp|P63037|DNJA1_MOUSE DnaJ homolog subfamily A member 1 OS=Mus musculus GN=Dnaja1 PE=1 SV=1 137 249 5.0E-14
sp|B2TLZ8|DNAJ_CLOBB Chaperone protein DnaJ OS=Clostridium botulinum (strain Eklund 17B / Type B) GN=dnaJ PE=3 SV=1 140 204 5.0E-14
sp|A2SIR5|DNAJ_METPP Chaperone protein DnaJ OS=Methylibium petroleiphilum (strain PM1) GN=dnaJ PE=3 SV=1 140 267 5.0E-14
sp|P59910|DJB13_HUMAN DnaJ homolog subfamily B member 13 OS=Homo sapiens GN=DNAJB13 PE=2 SV=1 140 248 5.0E-14
sp|Q835R5|DNAJ_ENTFA Chaperone protein DnaJ OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=dnaJ PE=3 SV=1 140 204 6.0E-14
sp|Q5F3Z5|DNJB6_CHICK DnaJ homolog subfamily B member 6 OS=Gallus gallus GN=DNAJB6 PE=2 SV=1 138 204 6.0E-14
sp|Q04960|DNJH_CUCSA DnaJ protein homolog OS=Cucumis sativus GN=DNAJ1 PE=2 SV=1 139 206 6.0E-14
sp|A1W0P5|DNAJ_CAMJJ Chaperone protein DnaJ OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=dnaJ PE=3 SV=1 141 226 6.0E-14
sp|Q9Z9E9|DNAJ_CHLPN Chaperone protein DnaJ OS=Chlamydia pneumoniae GN=dnaJ PE=3 SV=1 140 206 6.0E-14
sp|Q8CP18|DNAJ_STAES Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 12228) GN=dnaJ PE=3 SV=1 140 206 7.0E-14
sp|Q9KD71|DNAJ_BACHD Chaperone protein DnaJ OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=dnaJ PE=3 SV=1 140 204 7.0E-14
sp|Q9ZJQ2|DNAJ_HELPJ Chaperone protein DnaJ OS=Helicobacter pylori (strain J99 / ATCC 700824) GN=dnaJ PE=3 SV=1 141 228 7.0E-14
sp|Q5KWZ8|DNAJ_GEOKA Chaperone protein DnaJ OS=Geobacillus kaustophilus (strain HTA426) GN=dnaJ PE=3 SV=1 140 209 8.0E-14
sp|Q5XGU5|DNJ6B_XENLA DnaJ homolog subfamily B member 6-B OS=Xenopus laevis GN=dnajb6-b PE=2 SV=1 138 286 8.0E-14
sp|Q9RUG2|DNAJ_DEIRA Chaperone protein DnaJ OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=dnaJ PE=3 SV=2 140 207 9.0E-14
sp|Q6LUA6|DNAJ_PHOPR Chaperone protein DnaJ OS=Photobacterium profundum GN=dnaJ PE=3 SV=1 140 204 9.0E-14
sp|A5N6M3|DNAJ_CLOK5 Chaperone protein DnaJ OS=Clostridium kluyveri (strain ATCC 8527 / DSM 555 / NCIMB 10680) GN=dnaJ PE=3 SV=1 140 204 9.0E-14
sp|Q5WV16|DNAJ_LEGPL Chaperone protein DnaJ OS=Legionella pneumophila (strain Lens) GN=dnaJ PE=3 SV=1 140 240 9.0E-14
sp|P50025|DNAJ_LEGPN Chaperone protein DnaJ OS=Legionella pneumophila GN=dnaJ PE=3 SV=1 140 240 1.0E-13
sp|Q5ZTY4|DNAJ_LEGPH Chaperone protein DnaJ OS=Legionella pneumophila subsp. pneumophila (strain Philadelphia 1 / ATCC 33152 / DSM 7513) GN=dnaJ PE=3 SV=1 140 240 1.0E-13
sp|A5IDK7|DNAJ_LEGPC Chaperone protein DnaJ OS=Legionella pneumophila (strain Corby) GN=dnaJ PE=3 SV=1 140 240 1.0E-13
sp|Q5X3M8|DNAJ_LEGPA Chaperone protein DnaJ OS=Legionella pneumophila (strain Paris) GN=dnaJ PE=3 SV=1 140 240 1.0E-13
sp|Q5WHG0|DNAJ_BACSK Chaperone protein DnaJ OS=Bacillus clausii (strain KSM-K16) GN=dnaJ PE=3 SV=1 140 218 1.0E-13
sp|A4IR30|DNAJ_GEOTN Chaperone protein DnaJ OS=Geobacillus thermodenitrificans (strain NG80-2) GN=dnaJ PE=3 SV=1 140 249 1.0E-13
sp|Q5P9E0|DNAJ_ANAMM Chaperone protein DnaJ OS=Anaplasma marginale (strain St. Maries) GN=dnaJ PE=3 SV=1 140 222 1.0E-13
sp|B9KH92|DNAJ_ANAMF Chaperone protein DnaJ OS=Anaplasma marginale (strain Florida) GN=dnaJ PE=3 SV=1 140 222 1.0E-13
sp|B6IVA5|DNAJ_RHOCS Chaperone protein DnaJ OS=Rhodospirillum centenum (strain ATCC 51521 / SW) GN=dnaJ PE=3 SV=1 140 204 1.0E-13
sp|Q49Y21|DNAJ_STAS1 Chaperone protein DnaJ OS=Staphylococcus saprophyticus subsp. saprophyticus (strain ATCC 15305 / DSM 20229) GN=dnaJ PE=3 SV=1 140 249 1.0E-13
sp|B5YAR4|DNAJ_DICT6 Chaperone protein DnaJ OS=Dictyoglomus thermophilum (strain ATCC 35947 / DSM 3960 / H-6-12) GN=dnaJ PE=3 SV=1 140 252 1.0E-13
sp|Q044A8|DNAJ_LACGA Chaperone protein DnaJ OS=Lactobacillus gasseri (strain ATCC 33323 / DSM 20243 / JCM 1131 / NCIMB 11718 / AM63) GN=dnaJ PE=3 SV=1 140 204 1.0E-13
sp|Q5UP23|YR260_MIMIV DnaJ-like protein R260 OS=Acanthamoeba polyphaga mimivirus GN=MIMI_R260 PE=3 SV=1 139 242 1.0E-13
sp|C5BQ32|DNAJ_TERTT Chaperone protein DnaJ OS=Teredinibacter turnerae (strain ATCC 39867 / T7901) GN=dnaJ PE=3 SV=1 140 204 1.0E-13
sp|Q8TQR1|DNAJ_METAC Chaperone protein DnaJ OS=Methanosarcina acetivorans (strain ATCC 35395 / DSM 2834 / JCM 12185 / C2A) GN=dnaJ PE=3 SV=1 140 245 1.0E-13
sp|B2GBQ6|DNAJ_LACF3 Chaperone protein DnaJ OS=Lactobacillus fermentum (strain NBRC 3956 / LMG 18251) GN=dnaJ PE=3 SV=1 140 204 1.0E-13
sp|Q2KWA4|DNAJ_BORA1 Chaperone protein DnaJ OS=Bordetella avium (strain 197N) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|Q2GI75|DNAJ_EHRCR Chaperone protein DnaJ OS=Ehrlichia chaffeensis (strain ATCC CRL-10679 / Arkansas) GN=dnaJ PE=3 SV=1 139 243 2.0E-13
sp|Q0III6|DNJB6_BOVIN DnaJ homolog subfamily B member 6 OS=Bos taurus GN=DNAJB6 PE=2 SV=1 138 202 2.0E-13
sp|B1Y787|DNAJ_LEPCP Chaperone protein DnaJ OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=dnaJ PE=3 SV=1 140 216 2.0E-13
sp|Q74IT7|DNAJ_LACJO Chaperone protein DnaJ OS=Lactobacillus johnsonii (strain CNCM I-12250 / La1 / NCC 533) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|Q5HNW7|DNAJ_STAEQ Chaperone protein DnaJ OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=dnaJ PE=3 SV=1 140 206 2.0E-13
sp|A1JJD6|DNAJ_YERE8 Chaperone protein DnaJ OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|B8CXL0|DNAJ_HALOH Chaperone protein DnaJ OS=Halothermothrix orenii (strain H 168 / OCM 544 / DSM 9562) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|B0BTI6|DNAJ_ACTPJ Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 3 (strain JL03) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|Q1H3B9|DNAJ_METFK Chaperone protein DnaJ OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|A3N3J9|DNAJ_ACTP2 Chaperone protein DnaJ OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|A6LRN5|DNAJ_CLOB8 Chaperone protein DnaJ OS=Clostridium beijerinckii (strain ATCC 51743 / NCIMB 8052) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|Q84BU3|DNAJ_LACAC Chaperone protein DnaJ OS=Lactobacillus acidophilus (strain ATCC 700396 / NCK56 / N2 / NCFM) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|Q9ZFC5|DNAJ_METSS Chaperone protein DnaJ OS=Methylovorus sp. (strain SS1 / DSM 11726) GN=dnaJ PE=3 SV=1 140 204 2.0E-13
sp|A4G8D1|DNAJ_HERAR Chaperone protein DnaJ OS=Herminiimonas arsenicoxydans GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|Q88VM1|DNAJ_LACPL Chaperone protein DnaJ OS=Lactobacillus plantarum (strain ATCC BAA-793 / NCIMB 8826 / WCFS1) GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|A8G9K9|DNAJ_SERP5 Chaperone protein DnaJ OS=Serratia proteamaculans (strain 568) GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|O69269|DNAJ_LYSSH Chaperone protein DnaJ OS=Lysinibacillus sphaericus GN=dnaJ PE=3 SV=1 140 249 3.0E-13
sp|B1ZUS0|DNAJ_OPITP Chaperone protein DnaJ OS=Opitutus terrae (strain DSM 11246 / PB90-1) GN=dnaJ PE=3 SV=1 140 202 3.0E-13
sp|Q0C454|DNAJ_HYPNA Chaperone protein DnaJ OS=Hyphomonas neptunium (strain ATCC 15444) GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|Q4QJW5|DNAJ_HAEI8 Chaperone protein DnaJ OS=Haemophilus influenzae (strain 86-028NP) GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|Q0II91|DJC21_BOVIN DnaJ homolog subfamily C member 21 OS=Bos taurus GN=DNAJC21 PE=2 SV=2 141 201 3.0E-13
sp|P48208|DNAJ_HAEDU Chaperone protein DnaJ OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=dnaJ PE=3 SV=1 140 204 3.0E-13
sp|Q5L6F7|DNAJ_CHLAB Chaperone protein DnaJ OS=Chlamydophila abortus (strain DSM 27085 / S26/3) GN=dnaJ PE=3 SV=1 140 206 3.0E-13
sp|Q6KHF9|DNAJ_MYCMO Chaperone protein DnaJ OS=Mycoplasma mobile (strain ATCC 43663 / 163K / NCTC 11711) GN=dnaJ PE=3 SV=1 140 315 3.0E-13
sp|P48207|DNAJ_FRATU Chaperone protein DnaJ OS=Francisella tularensis GN=dnaJ PE=3 SV=1 141 249 4.0E-13
sp|Q2A327|DNAJ_FRATH Chaperone protein DnaJ OS=Francisella tularensis subsp. holarctica (strain LVS) GN=dnaJ PE=3 SV=1 141 249 4.0E-13
sp|C4L424|DNAJ_EXISA Chaperone protein DnaJ OS=Exiguobacterium sp. (strain ATCC BAA-1283 / AT1b) GN=dnaJ PE=3 SV=1 140 249 4.0E-13
sp|C3LTA6|DNAJ_VIBCM Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain M66-2) GN=dnaJ PE=3 SV=1 140 204 4.0E-13
sp|O34242|DNAJ_VIBCH Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=dnaJ PE=3 SV=2 140 204 4.0E-13
sp|A5F362|DNAJ_VIBC3 Chaperone protein DnaJ OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=dnaJ PE=3 SV=1 140 204 4.0E-13
sp|Q7MN84|DNAJ_VIBVY Chaperone protein DnaJ OS=Vibrio vulnificus (strain YJ016) GN=dnaJ PE=3 SV=2 140 204 4.0E-13
sp|Q8DF67|DNAJ_VIBVU Chaperone protein DnaJ OS=Vibrio vulnificus (strain CMCP6) GN=dnaJ PE=3 SV=1 140 204 4.0E-13
sp|Q5FGQ8|DNAJ_EHRRG Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Gardel) GN=dnaJ PE=3 SV=1 139 222 4.0E-13
sp|P35514|DNAJ_LACLA Chaperone protein DnaJ OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=dnaJ PE=3 SV=2 139 204 4.0E-13
sp|Q5HCG4|DNAJ_EHRRW Chaperone protein DnaJ OS=Ehrlichia ruminantium (strain Welgevonden) GN=dnaJ PE=3 SV=1 139 222 4.0E-13
sp|A7Z6W0|DNAJ_BACMF Chaperone protein DnaJ OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=dnaJ PE=3 SV=1 140 204 4.0E-13
sp|Q55505|DNAJ1_SYNY3 Chaperone protein DnaJ 1 OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=dnaJ1 PE=3 SV=1 140 218 4.0E-13
sp|Q5P1H7|DNAJ2_AROAE Chaperone protein DnaJ 2 OS=Aromatoleum aromaticum (strain EbN1) GN=dnaJ2 PE=3 SV=1 140 224 4.0E-13
sp|Q7V3Q3|DNAJ_PROMP Chaperone protein DnaJ OS=Prochlorococcus marinus subsp. pastoris (strain CCMP1986 / MED4) GN=dnaJ PE=3 SV=1 138 224 5.0E-13
sp|Q4R7Y5|DNJB6_MACFA DnaJ homolog subfamily B member 6 OS=Macaca fascicularis GN=DNAJB6 PE=2 SV=1 138 202 5.0E-13
sp|Q7NBW0|DNAJ_MYCGA Chaperone protein DnaJ OS=Mycoplasma gallisepticum (strain R(low / passage 15 / clone 2)) GN=dnaJ PE=3 SV=2 140 270 5.0E-13
sp|A4IX29|DNAJ_FRATW Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain WY96-3418) GN=dnaJ PE=3 SV=1 141 249 5.0E-13
sp|Q5N0G1|DNAJ_SYNP6 Chaperone protein DnaJ OS=Synechococcus sp. (strain ATCC 27144 / PCC 6301 / SAUG 1402/1) GN=dnaJ PE=3 SV=1 140 202 5.0E-13
sp|A8GMF8|DNAJ_RICAH Chaperone protein DnaJ OS=Rickettsia akari (strain Hartford) GN=dnaJ PE=3 SV=1 140 252 5.0E-13
sp|Q0AIY0|DNAJ_NITEC Chaperone protein DnaJ OS=Nitrosomonas eutropha (strain C91) GN=dnaJ PE=3 SV=1 140 204 5.0E-13
sp|Q6AEC0|DNAJ_LEIXX Chaperone protein DnaJ OS=Leifsonia xyli subsp. xyli (strain CTCB07) GN=dnaJ PE=3 SV=1 138 202 5.0E-13
sp|Q2SMM7|DNAJ_HAHCH Chaperone protein DnaJ OS=Hahella chejuensis (strain KCTC 2396) GN=dnaJ PE=3 SV=1 140 204 5.0E-13
sp|Q049W7|DNAJ_LACDB Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC BAA-365) GN=dnaJ PE=3 SV=1 140 233 5.0E-13
sp|Q1G9R3|DNAJ_LACDA Chaperone protein DnaJ OS=Lactobacillus delbrueckii subsp. bulgaricus (strain ATCC 11842 / DSM 20081 / JCM 1002 / NBRC 13953 / NCIMB 11778) GN=dnaJ PE=3 SV=1 140 233 5.0E-13
sp|A7MWW1|DNAJ_VIBCB Chaperone protein DnaJ OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=dnaJ PE=3 SV=1 140 204 6.0E-13
sp|Q2JH49|DNAJ_SYNJB Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-2-3B'a(2-13)) GN=dnaJ PE=3 SV=1 140 202 6.0E-13
sp|Q3YT99|DNAJ_EHRCJ Chaperone protein DnaJ OS=Ehrlichia canis (strain Jake) GN=dnaJ PE=3 SV=1 139 243 6.0E-13
sp|Q2JW78|DNAJ_SYNJA Chaperone protein DnaJ OS=Synechococcus sp. (strain JA-3-3Ab) GN=dnaJ PE=3 SV=1 140 202 6.0E-13
sp|P0DA71|DNAJ_STRPQ Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain SSI-1) GN=dnaJ PE=3 SV=1 139 202 6.0E-13
sp|P0DA70|DNAJ_STRP3 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M3 (strain ATCC BAA-595 / MGAS315) GN=dnaJ PE=3 SV=1 139 202 6.0E-13
sp|P0C0B6|DNAJ_STRP1 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M1 GN=dnaJ PE=3 SV=1 139 202 6.0E-13
sp|C0ZB49|DNAJ_BREBN Chaperone protein DnaJ OS=Brevibacillus brevis (strain 47 / JCM 6285 / NBRC 100599) GN=dnaJ PE=3 SV=1 140 204 6.0E-13
sp|Q8NZM7|DNAJ_STRP8 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M18 (strain MGAS8232) GN=dnaJ PE=3 SV=1 139 202 6.0E-13
sp|Q5XAD7|DNAJ_STRP6 Chaperone protein DnaJ OS=Streptococcus pyogenes serotype M6 (strain ATCC BAA-946 / MGAS10394) GN=dnaJ PE=3 SV=2 139 202 6.0E-13
sp|Q5F1R6|DJC21_HUMAN DnaJ homolog subfamily C member 21 OS=Homo sapiens GN=DNAJC21 PE=1 SV=2 141 201 6.0E-13
sp|A8EUC7|DNAJ_ARCB4 Chaperone protein DnaJ OS=Arcobacter butzleri (strain RM4018) GN=dnaJ PE=3 SV=1 140 204 6.0E-13
sp|P0C0B5|DNAJ_STRPY Chaperone protein DnaJ OS=Streptococcus pyogenes GN=dnaJ PE=3 SV=1 139 202 6.0E-13
sp|Q49762|DNAJ2_MYCLE Chaperone protein DnaJ 2 OS=Mycobacterium leprae (strain TN) GN=dnaJ2 PE=3 SV=1 140 267 6.0E-13
sp|A5WBF8|DNAJ_PSYWF Chaperone protein DnaJ OS=Psychrobacter sp. (strain PRwf-1) GN=dnaJ PE=3 SV=1 140 204 7.0E-13
sp|B0CAZ0|DNAJ_ACAM1 Chaperone protein DnaJ OS=Acaryochloris marina (strain MBIC 11017) GN=dnaJ PE=3 SV=1 140 253 7.0E-13
sp|Q6VAY5|DNAJ_PSEST Chaperone protein DnaJ OS=Pseudomonas stutzeri GN=dnaJ PE=3 SV=1 140 204 7.0E-13
sp|O27352|DNAJ_METTH Chaperone protein DnaJ OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=dnaJ PE=3 SV=1 140 224 7.0E-13
sp|Q8FNF5|DNAJ1_COREF Chaperone protein DnaJ 1 OS=Corynebacterium efficiens (strain DSM 44549 / YS-314 / AJ 12310 / JCM 11189 / NBRC 100395) GN=dnaJ1 PE=3 SV=1 140 271 8.0E-13
sp|A7I2G3|DNAJ_CAMHC Chaperone protein DnaJ OS=Campylobacter hominis (strain ATCC BAA-381 / LMG 19568 / NCTC 13146 / CH001A) GN=dnaJ PE=3 SV=1 138 204 8.0E-13
sp|Q9KJT8|DNAJ_PEWBP Chaperone protein DnaJ OS=Peanut witches'-broom phytoplasma GN=dnaJ PE=3 SV=1 140 247 8.0E-13
sp|Q182E7|DNAJ_PEPD6 Chaperone protein DnaJ OS=Peptoclostridium difficile (strain 630) GN=dnaJ PE=3 SV=1 140 206 8.0E-13
sp|A8IPT0|DNAJ_AZOC5 Chaperone protein DnaJ OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=dnaJ PE=3 SV=1 140 255 8.0E-13
sp|Q93Q66|DNAJ_LACLC Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris GN=dnaJ PE=3 SV=1 139 204 9.0E-13
sp|Q2NVZ0|DNAJ_SODGM Chaperone protein DnaJ OS=Sodalis glossinidius (strain morsitans) GN=dnaJ PE=3 SV=1 139 204 9.0E-13
sp|Q7V9C8|DNAJ_PROMM Chaperone protein DnaJ OS=Prochlorococcus marinus (strain MIT 9313) GN=dnaJ PE=3 SV=1 138 202 9.0E-13
sp|Q3A8C3|DNAJ_PELCD Chaperone protein DnaJ OS=Pelobacter carbinolicus (strain DSM 2380 / Gra Bd 1) GN=dnaJ PE=3 SV=1 140 202 9.0E-13
sp|B1WVR2|DNAJ_CYAA5 Chaperone protein DnaJ OS=Cyanothece sp. (strain ATCC 51142) GN=dnaJ PE=3 SV=1 140 227 9.0E-13
sp|Q7WGI5|DNAJ_BORBR Chaperone protein DnaJ OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=dnaJ PE=3 SV=1 140 204 9.0E-13
sp|Q7NXI1|DNAJ_CHRVO Chaperone protein DnaJ OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=dnaJ PE=3 SV=1 140 208 9.0E-13
sp|Q7W520|DNAJ_BORPA Chaperone protein DnaJ OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=dnaJ PE=3 SV=1 140 204 9.0E-13
sp|Q6P642|DNJB6_XENTR DnaJ homolog subfamily B member 6 OS=Xenopus tropicalis GN=dnajb6 PE=2 SV=1 138 202 1.0E-12
sp|B3CVD9|DNAJ_ORITI Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Ikeda) GN=dnaJ PE=3 SV=1 140 251 1.0E-12
sp|B8I304|DNAJ_CLOCE Chaperone protein DnaJ OS=Clostridium cellulolyticum (strain ATCC 35319 / DSM 5812 / JCM 6584 / H10) GN=dnaJ PE=3 SV=1 140 227 1.0E-12
sp|Q7VVY3|DNAJ_BORPE Chaperone protein DnaJ OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q68XI3|DNAJ_RICTY Chaperone protein DnaJ OS=Rickettsia typhi (strain ATCC VR-144 / Wilmington) GN=dnaJ PE=3 SV=1 140 251 1.0E-12
sp|P17631|DNAJ_BACSU Chaperone protein DnaJ OS=Bacillus subtilis (strain 168) GN=dnaJ PE=2 SV=3 140 204 1.0E-12
sp|Q5SLW9|DNAJ1_THET8 Chaperone protein DnaJ 1 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ1 PE=3 SV=1 138 211 1.0E-12
sp|A6T225|DNAJ_JANMA Chaperone protein DnaJ OS=Janthinobacterium sp. (strain Marseille) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q72GN6|DNAJ_THET2 Chaperone protein DnaJ OS=Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039) GN=dnaJ PE=3 SV=1 138 211 1.0E-12
sp|A2RP20|DNAJ_LACLM Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain MG1363) GN=dnaJ PE=3 SV=1 139 204 1.0E-12
sp|Q02VR5|DNAJ_LACLS Chaperone protein DnaJ OS=Lactococcus lactis subsp. cremoris (strain SK11) GN=dnaJ PE=3 SV=1 139 204 1.0E-12
sp|A1V9Q3|DNAJ_DESVV Chaperone protein DnaJ OS=Desulfovibrio vulgaris subsp. vulgaris (strain DP4) GN=dnaJ PE=3 SV=1 140 202 1.0E-12
sp|Q725M6|DNAJ_DESVH Chaperone protein DnaJ OS=Desulfovibrio vulgaris (strain Hildenborough / ATCC 29579 / NCIMB 8303) GN=dnaJ PE=3 SV=1 140 202 1.0E-12
sp|B4F2V6|DNAJ_PROMH Chaperone protein DnaJ OS=Proteus mirabilis (strain HI4320) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q9XCA6|DNAJ_PORGI Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC BAA-308 / W83) GN=dnaJ PE=3 SV=1 140 202 1.0E-12
sp|Q823T2|DNAJ_CHLCV Chaperone protein DnaJ OS=Chlamydophila caviae (strain GPIC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|P47265|DNAJ_MYCGE Chaperone protein DnaJ OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=dnaJ PE=3 SV=1 140 307 1.0E-12
sp|B5YYA8|DNAJ_ECO5E Chaperone protein DnaJ OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q32KA4|DNAJ_SHIDS Chaperone protein DnaJ OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q0K758|DNAJ_CUPNH Chaperone protein DnaJ OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q3Z600|DNAJ_SHISS Chaperone protein DnaJ OS=Shigella sonnei (strain Ss046) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7LVP7|DNAJ_ESCF3 Chaperone protein DnaJ OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q1RGI7|DNAJ_ECOUT Chaperone protein DnaJ OS=Escherichia coli (strain UTI89 / UPEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B1LFU5|DNAJ_ECOSM Chaperone protein DnaJ OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B6HZ11|DNAJ_ECOSE Chaperone protein DnaJ OS=Escherichia coli (strain SE11) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7N7N9|DNAJ_ECOLU Chaperone protein DnaJ OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B1IRF9|DNAJ_ECOLC Chaperone protein DnaJ OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q8FLC5|DNAJ_ECOL6 Chaperone protein DnaJ OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=dnaJ PE=3 SV=3 140 204 1.0E-12
sp|A7ZVV8|DNAJ_ECOHS Chaperone protein DnaJ OS=Escherichia coli O9:H4 (strain HS) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7M0B1|DNAJ_ECO8A Chaperone protein DnaJ OS=Escherichia coli O8 (strain IAI1) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7MNM2|DNAJ_ECO81 Chaperone protein DnaJ OS=Escherichia coli O81 (strain ED1a) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7NHB7|DNAJ_ECO7I Chaperone protein DnaJ OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q8XA65|DNAJ_ECO57 Chaperone protein DnaJ OS=Escherichia coli O157:H7 GN=dnaJ PE=3 SV=3 140 204 1.0E-12
sp|B7L4D9|DNAJ_ECO55 Chaperone protein DnaJ OS=Escherichia coli (strain 55989 / EAEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7MAD6|DNAJ_ECO45 Chaperone protein DnaJ OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B7UI60|DNAJ_ECO27 Chaperone protein DnaJ OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|A7ZHA5|DNAJ_ECO24 Chaperone protein DnaJ OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B5BLH9|DNAJ_SALPK Chaperone protein DnaJ OS=Salmonella paratyphi A (strain AKU_12601) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q5PDJ4|DNAJ_SALPA Chaperone protein DnaJ OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=dnaJ PE=3 SV=3 140 204 1.0E-12
sp|A5FZ18|DNAJ_ACICJ Chaperone protein DnaJ OS=Acidiphilium cryptum (strain JF-5) GN=dnaJ PE=3 SV=1 139 204 1.0E-12
sp|P0A1G7|DNAJ_SALTY Chaperone protein DnaJ OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=dnaJ PE=3 SV=2 140 204 1.0E-12
sp|P0A1G8|DNAJ_SALTI Chaperone protein DnaJ OS=Salmonella typhi GN=dnaJ PE=3 SV=2 140 204 1.0E-12
sp|B4TVZ6|DNAJ_SALSV Chaperone protein DnaJ OS=Salmonella schwarzengrund (strain CVM19633) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|C0Q4F4|DNAJ_SALPC Chaperone protein DnaJ OS=Salmonella paratyphi C (strain RKS4594) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|A9MXI3|DNAJ_SALPB Chaperone protein DnaJ OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B4T6D7|DNAJ_SALNS Chaperone protein DnaJ OS=Salmonella newport (strain SL254) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B4TIB5|DNAJ_SALHS Chaperone protein DnaJ OS=Salmonella heidelberg (strain SL476) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B5RF09|DNAJ_SALG2 Chaperone protein DnaJ OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B5R5I3|DNAJ_SALEP Chaperone protein DnaJ OS=Salmonella enteritidis PT4 (strain P125109) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B5FHA7|DNAJ_SALDC Chaperone protein DnaJ OS=Salmonella dublin (strain CT_02021853) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q57TP2|DNAJ_SALCH Chaperone protein DnaJ OS=Salmonella choleraesuis (strain SC-B67) GN=dnaJ PE=3 SV=3 140 204 1.0E-12
sp|B5F6Y9|DNAJ_SALA4 Chaperone protein DnaJ OS=Salmonella agona (strain SL483) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q326K6|DNAJ_SHIBS Chaperone protein DnaJ OS=Shigella boydii serotype 4 (strain Sb227) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|B2U233|DNAJ_SHIB3 Chaperone protein DnaJ OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q03QU2|DNAJ_LACBA Chaperone protein DnaJ OS=Lactobacillus brevis (strain ATCC 367 / JCM 1170) GN=dnaJ PE=3 SV=1 139 204 1.0E-12
sp|P43735|DNAJ_HAEIN Chaperone protein DnaJ OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=dnaJ PE=3 SV=1 140 204 1.0E-12
sp|Q253T6|DNAJ_CHLFF Chaperone protein DnaJ OS=Chlamydophila felis (strain Fe/C-56) GN=dnaJ PE=3 SV=1 140 206 1.0E-12
sp|C3MC05|DNAJ_RHISN Chaperone protein DnaJ OS=Rhizobium sp. (strain NGR234) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|A5CD86|DNAJ_ORITB Chaperone protein DnaJ OS=Orientia tsutsugamushi (strain Boryong) GN=dnaJ PE=3 SV=1 140 251 2.0E-12
sp|O34136|DNAJ_DEIPM Chaperone protein DnaJ OS=Deinococcus proteolyticus (strain ATCC 35074 / DSM 20540 / JCM 6276 / NBRC 101906 / NCIMB 13154 / VKM Ac-1939 / CCM 2703 / MRP) GN=dnaJ PE=3 SV=2 140 204 2.0E-12
sp|O87385|DNAJ_VIBHA Chaperone protein DnaJ OS=Vibrio harveyi GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B6EKA0|DNAJ_ALISL Chaperone protein DnaJ OS=Aliivibrio salmonicida (strain LFI1238) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q9ZSY2|DNJ15_ARATH Chaperone protein dnaJ 15 OS=Arabidopsis thaliana GN=ATJ15 PE=1 SV=1 142 232 2.0E-12
sp|Q8DWH2|DNAJ_STRMU Chaperone protein DnaJ OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q21H37|DNAJ_SACD2 Chaperone protein DnaJ OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B5Y241|DNAJ_KLEP3 Chaperone protein DnaJ OS=Klebsiella pneumoniae (strain 342) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|A6T4F5|DNAJ_KLEP7 Chaperone protein DnaJ OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|C1DD87|DNAJ_LARHH Chaperone protein DnaJ OS=Laribacter hongkongensis (strain HLHK9) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|A8FFD1|DNAJ_BACP2 Chaperone protein DnaJ OS=Bacillus pumilus (strain SAFR-032) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q5NSW9|DNAJ_BURM1 Chaperone protein DnaJ OS=Burkholderia multivorans (strain ATCC 17616 / 249) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B9DVF2|DNAJ_STRU0 Chaperone protein DnaJ OS=Streptococcus uberis (strain ATCC BAA-854 / 0140J) GN=dnaJ PE=3 SV=1 139 202 2.0E-12
sp|C4L8Y4|DNAJ_TOLAT Chaperone protein DnaJ OS=Tolumonas auensis (strain DSM 9187 / TA4) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q98PI9|DNAJ_MYCPU Chaperone protein DnaJ OS=Mycoplasma pulmonis (strain UAB CTIP) GN=dnaJ PE=3 SV=2 137 248 2.0E-12
sp|B0VA24|DNAJ_ACIBY Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AYE) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|A3MA88|DNAJ_ACIBT Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ATCC 17978 / CIP 53.77 / LMG 1025 / NCDC KC755 / 5377) GN=dnaJ PE=3 SV=2 140 204 2.0E-12
sp|B0VQ00|DNAJ_ACIBS Chaperone protein DnaJ OS=Acinetobacter baumannii (strain SDF) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B2I2G6|DNAJ_ACIBC Chaperone protein DnaJ OS=Acinetobacter baumannii (strain ACICU) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B7I2B2|DNAJ_ACIB5 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB0057) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B7GV08|DNAJ_ACIB3 Chaperone protein DnaJ OS=Acinetobacter baumannii (strain AB307-0294) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q2VYT0|DNAJ_MAGSA Chaperone protein DnaJ OS=Magnetospirillum magneticum (strain AMB-1 / ATCC 700264) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q9ZDY0|DNAJ_RICPR Chaperone protein DnaJ OS=Rickettsia prowazekii (strain Madrid E) GN=dnaJ PE=3 SV=1 140 243 2.0E-12
sp|O66921|DNAJ2_AQUAE Chaperone protein DnaJ 2 OS=Aquifex aeolicus (strain VF5) GN=dnaJ2 PE=3 SV=1 140 251 2.0E-12
sp|A9IGC5|DNAJ_BORPD Chaperone protein DnaJ OS=Bordetella petrii (strain ATCC BAA-461 / DSM 12804 / CCUG 43448) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B3R6G6|DNAJ_CUPTR Chaperone protein DnaJ OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q8CXD3|DNAJ_OCEIH Chaperone protein DnaJ OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=dnaJ PE=3 SV=1 140 249 2.0E-12
sp|A0KMI5|DNAJ_AERHH Chaperone protein DnaJ OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q7VQL3|DNAJ_BLOFL Chaperone protein DnaJ OS=Blochmannia floridanus GN=dnaJ PE=3 SV=1 139 204 2.0E-12
sp|Q15UD2|DNAJ_PSEA6 Chaperone protein DnaJ OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q7VEJ6|DNAJ_PROMA Chaperone protein DnaJ OS=Prochlorococcus marinus (strain SARG / CCMP1375 / SS120) GN=dnaJ PE=3 SV=1 138 227 2.0E-12
sp|B2SXC7|DNAJ_BURPP Chaperone protein DnaJ OS=Burkholderia phytofirmans (strain DSM 17436 / PsJN) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|Q145F0|DNAJ_BURXL Chaperone protein DnaJ OS=Burkholderia xenovorans (strain LB400) GN=dnaJ PE=3 SV=1 140 204 2.0E-12
sp|B5ENA2|DNAJ_ACIF5 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 53993) GN=dnaJ PE=3 SV=1 140 202 2.0E-12
sp|B7J7X8|DNAJ_ACIF2 Chaperone protein DnaJ OS=Acidithiobacillus ferrooxidans (strain ATCC 23270 / DSM 14882 / CIP 104768 / NCIMB 8455) GN=dnaJ PE=3 SV=1 140 202 2.0E-12
sp|Q7VG06|DNAJ_HELHP Chaperone protein DnaJ OS=Helicobacter hepaticus (strain ATCC 51449 / 3B1) GN=dnaJ PE=3 SV=1 140 228 2.0E-12
sp|O75190|DNJB6_HUMAN DnaJ homolog subfamily B member 6 OS=Homo sapiens GN=DNAJB6 PE=1 SV=2 138 202 2.0E-12
sp|Q56237|DNAJ2_THET8 Chaperone protein DnaJ 2 OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=dnaJ2 PE=3 SV=2 140 222 3.0E-12
sp|Q6AYU3|DNJB6_RAT DnaJ homolog subfamily B member 6 OS=Rattus norvegicus GN=Dnajb6 PE=1 SV=1 138 248 3.0E-12
sp|C4ZPU1|DNAJ_ECOBW Chaperone protein DnaJ OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q5R8H0|DNJB6_PONAB DnaJ homolog subfamily B member 6 OS=Pongo abelii GN=DNAJB6 PE=2 SV=1 138 202 3.0E-12
sp|Q87RX2|DNAJ_VIBPA Chaperone protein DnaJ OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q0T8H5|DNAJ_SHIF8 Chaperone protein DnaJ OS=Shigella flexneri serotype 5b (strain 8401) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|P08622|DNAJ_ECOLI Chaperone protein DnaJ OS=Escherichia coli (strain K12) GN=dnaJ PE=1 SV=3 140 204 3.0E-12
sp|B1XBE0|DNAJ_ECODH Chaperone protein DnaJ OS=Escherichia coli (strain K12 / DH10B) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|C5B7L8|DNAJ_EDWI9 Chaperone protein DnaJ OS=Edwardsiella ictaluri (strain 93-146) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q67S53|DNAJ_SYMTH Chaperone protein DnaJ OS=Symbiobacterium thermophilum (strain T / IAM 14863) GN=dnaJ PE=3 SV=1 140 248 3.0E-12
sp|A1TLH8|DNAJ_ACIAC Chaperone protein DnaJ OS=Acidovorax citrulli (strain AAC00-1) GN=dnaJ PE=3 SV=1 140 210 3.0E-12
sp|B0U833|DNAJ_METS4 Chaperone protein DnaJ OS=Methylobacterium sp. (strain 4-46) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q8D2Q6|DNAJ_WIGBR Chaperone protein DnaJ OS=Wigglesworthia glossinidia brevipalpis GN=dnaJ PE=3 SV=1 139 251 3.0E-12
sp|B2JGE1|DNAJ_BURP8 Chaperone protein DnaJ OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q7UDU1|DNAJ_SHIFL Chaperone protein DnaJ OS=Shigella flexneri GN=dnaJ PE=3 SV=3 140 204 3.0E-12
sp|Q2SYZ3|DNAJ_BURTA Chaperone protein DnaJ OS=Burkholderia thailandensis (strain E264 / ATCC 700388 / DSM 13276 / CIP 106301) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|A1K4C4|DNAJ_AZOSB Chaperone protein DnaJ OS=Azoarcus sp. (strain BH72) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q09912|PSI1_SCHPO Protein psi1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=psi1 PE=2 SV=2 139 204 3.0E-12
sp|Q5E3A8|DNAJ_VIBF1 Chaperone protein DnaJ OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q1LJ82|DNAJ_CUPMC Chaperone protein DnaJ OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|A7GT07|DNAJ_BACCN Chaperone protein DnaJ OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=dnaJ PE=3 SV=1 140 249 3.0E-12
sp|Q6F6R1|DNAJ_ACIAD Chaperone protein DnaJ OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|B8GNX2|DNAJ_THISH Chaperone protein DnaJ OS=Thioalkalivibrio sulfidiphilus (strain HL-EbGR7) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q73Q15|DNAJ_TREDE Chaperone protein DnaJ OS=Treponema denticola (strain ATCC 35405 / CIP 103919 / DSM 14222) GN=dnaJ PE=3 SV=2 140 204 3.0E-12
sp|A9MR76|DNAJ_SALAR Chaperone protein DnaJ OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=dnaJ PE=3 SV=1 140 204 3.0E-12
sp|Q862Z4|DNJB3_MACFU DnaJ homolog subfamily B member 3 OS=Macaca fuscata fuscata GN=DNAJB3 PE=2 SV=1 138 204 4.0E-12
sp|Q5NFG8|DNAJ_FRATT Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain SCHU S4 / Schu 4) GN=dnaJ PE=3 SV=1 141 249 4.0E-12
sp|Q14GX0|DNAJ_FRAT1 Chaperone protein DnaJ OS=Francisella tularensis subsp. tularensis (strain FSC 198) GN=dnaJ PE=3 SV=1 141 249 4.0E-12
sp|B2RLJ0|DNAJ_PORG3 Chaperone protein DnaJ OS=Porphyromonas gingivalis (strain ATCC 33277 / DSM 20709 / JCM 12257) GN=dnaJ PE=3 SV=1 140 202 4.0E-12
sp|Q8E298|DNAJ_STRA5 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype V (strain ATCC BAA-611 / 2603 V/R) GN=dnaJ PE=3 SV=1 139 202 4.0E-12
sp|A7FME2|DNAJ_YERP3 Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q607A6|DNAJ_METCA Chaperone protein DnaJ OS=Methylococcus capsulatus (strain ATCC 33009 / NCIMB 11132 / Bath) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q8E7Q7|DNAJ_STRA3 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype III (strain NEM316) GN=dnaJ PE=3 SV=1 139 202 4.0E-12
sp|Q2S030|DNAJ_SALRD Chaperone protein DnaJ OS=Salinibacter ruber (strain DSM 13855 / M31) GN=dnaJ PE=3 SV=1 140 206 4.0E-12
sp|B1JL03|DNAJ_YERPY Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q66ES9|DNAJ_YERPS Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A4TQF8|DNAJ_YERPP Chaperone protein DnaJ OS=Yersinia pestis (strain Pestoides F) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q1CMV6|DNAJ_YERPN Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A9R014|DNAJ_YERPG Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Angola) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q8ZIM6|DNAJ_YERPE Chaperone protein DnaJ OS=Yersinia pestis GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|B2K3M1|DNAJ_YERPB Chaperone protein DnaJ OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q1C0J8|DNAJ_YERPA Chaperone protein DnaJ OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q8WWF6|DNJB3_HUMAN DnaJ homolog subfamily B member 3 OS=Homo sapiens GN=DNAJB3 PE=1 SV=1 138 248 4.0E-12
sp|A3ND66|DNAJ_BURP6 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 668) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A3NYX5|DNAJ_BURP0 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1106a) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q1RHG9|DNAJ_RICBR Chaperone protein DnaJ OS=Rickettsia bellii (strain RML369-C) GN=dnaJ PE=3 SV=1 140 254 4.0E-12
sp|B8IHL2|DNAJ_METNO Chaperone protein DnaJ OS=Methylobacterium nodulans (strain ORS2060 / LMG 21967) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q63R47|DNAJ_BURPS Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain K96243) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q3JP12|DNAJ_BURP1 Chaperone protein DnaJ OS=Burkholderia pseudomallei (strain 1710b) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A1V0U8|DNAJ_BURMS Chaperone protein DnaJ OS=Burkholderia mallei (strain SAVP1) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q62HD6|DNAJ_BURMA Chaperone protein DnaJ OS=Burkholderia mallei (strain ATCC 23344) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A2S563|DNAJ_BURM9 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10229) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|A3MN97|DNAJ_BURM7 Chaperone protein DnaJ OS=Burkholderia mallei (strain NCTC 10247) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q39JC7|DNAJ_BURL3 Chaperone protein DnaJ OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=dnaJ PE=3 SV=1 140 204 4.0E-12
sp|Q493S6|DNAJ_BLOPB Chaperone protein DnaJ OS=Blochmannia pennsylvanicus (strain BPEN) GN=dnaJ PE=3 SV=1 139 204 4.0E-12
sp|B8F7S3|DNAJ_HAEPS Chaperone protein DnaJ OS=Haemophilus parasuis serovar 5 (strain SH0165) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|Q0BI17|DNAJ_BURCM Chaperone protein DnaJ OS=Burkholderia ambifaria (strain ATCC BAA-244 / AMMD) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|B1YTK1|DNAJ_BURA4 Chaperone protein DnaJ OS=Burkholderia ambifaria (strain MC40-6) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|B1YKT0|DNAJ_EXIS2 Chaperone protein DnaJ OS=Exiguobacterium sibiricum (strain DSM 17290 / JCM 13490 / 255-15) GN=dnaJ PE=3 SV=1 140 249 5.0E-12
sp|B4EDZ1|DNAJ_BURCJ Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain ATCC BAA-245 / DSM 16553 / LMG 16656 / NCTC 13227 / J2315 / CF5610) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|A0K4S9|DNAJ_BURCH Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain HI2424) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|B1JW20|DNAJ_BURCC Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain MC0-3) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|Q1BYX2|DNAJ_BURCA Chaperone protein DnaJ OS=Burkholderia cenocepacia (strain AU 1054) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|Q65H55|DNAJ_BACLD Chaperone protein DnaJ OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|A1WAR7|DNAJ_ACISJ Chaperone protein DnaJ OS=Acidovorax sp. (strain JS42) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|A8GV67|DNAJ_RICB8 Chaperone protein DnaJ OS=Rickettsia bellii (strain OSU 85-389) GN=dnaJ PE=3 SV=1 140 254 5.0E-12
sp|A3DF24|DNAJ_CLOTH Chaperone protein DnaJ OS=Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|O33529|DNAJ_RHILE Chaperone protein DnaJ (Fragment) OS=Rhizobium leguminosarum GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|O54946|DNJB6_MOUSE DnaJ homolog subfamily B member 6 OS=Mus musculus GN=Dnajb6 PE=1 SV=4 138 204 5.0E-12
sp|B0SRF0|DNAJ_LEPBP Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=dnaJ PE=3 SV=1 141 202 5.0E-12
sp|B0SHT0|DNAJ_LEPBA Chaperone protein DnaJ OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=dnaJ PE=3 SV=1 141 202 5.0E-12
sp|P22305|DNAJ_CAUCR Chaperone protein DnaJ OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=dnaJ PE=3 SV=2 138 204 5.0E-12
sp|Q2HJ94|DNJA2_BOVIN DnaJ homolog subfamily A member 2 OS=Bos taurus GN=DNAJA2 PE=2 SV=1 139 250 5.0E-12
sp|B7KSZ5|DNAJ_METC4 Chaperone protein DnaJ OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=dnaJ PE=3 SV=1 140 204 5.0E-12
sp|A0LJ41|DNAJ_SYNFM Chaperone protein DnaJ OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=dnaJ PE=3 SV=1 140 222 6.0E-12
sp|Q7NDG8|DNAJ_GLOVI Chaperone protein DnaJ OS=Gloeobacter violaceus (strain PCC 7421) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|Q24SS4|DNAJ_DESHY Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain Y51) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|B8FUN3|DNAJ_DESHD Chaperone protein DnaJ OS=Desulfitobacterium hafniense (strain DCB-2 / DSM 10664) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|A9W6R8|DNAJ_METEP Chaperone protein DnaJ OS=Methylobacterium extorquens (strain PA1) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|B9MJZ0|DNAJ_CALBD Chaperone protein DnaJ OS=Caldicellulosiruptor bescii (strain ATCC BAA-1888 / DSM 6725 / Z-1320) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|A7MIK3|DNAJ_CROS8 Chaperone protein DnaJ OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=dnaJ PE=3 SV=1 140 204 6.0E-12
sp|Q8CWT2|DNAJ_STRR6 Chaperone protein DnaJ OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=dnaJ PE=3 SV=1 139 202 6.0E-12
sp|Q8MPX3|DNJ20_CAEEL DnaJ homolog dnj-20 OS=Caenorhabditis elegans GN=dnj-20 PE=3 SV=2 140 204 6.0E-12
sp|Q11KJ5|DNAJ_CHESB Chaperone protein DnaJ OS=Chelativorans sp. (strain BNC1) GN=dnaJ PE=3 SV=1 140 252 6.0E-12
sp|P95830|DNAJ_STRPN Chaperone protein DnaJ OS=Streptococcus pneumoniae serotype 4 (strain ATCC BAA-334 / TIGR4) GN=dnaJ PE=1 SV=2 139 202 6.0E-12
sp|A4W6D6|DNAJ_ENT38 Chaperone protein DnaJ OS=Enterobacter sp. (strain 638) GN=dnaJ PE=3 SV=1 140 204 7.0E-12
sp|P25491|MAS5_YEAST Mitochondrial protein import protein MAS5 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YDJ1 PE=1 SV=1 137 206 7.0E-12
sp|Q3AF07|DNAJ_CARHZ Chaperone protein DnaJ OS=Carboxydothermus hydrogenoformans (strain ATCC BAA-161 / DSM 6008 / Z-2901) GN=dnaJ PE=3 SV=1 140 204 7.0E-12
sp|P0CD63|Y5729_DICDI J domain-containing protein DDB_G0295729 OS=Dictyostelium discoideum GN=DDB_G0295729 PE=3 SV=1 121 201 7.0E-12
sp|A6UEY1|DNAJ_SINMW Chaperone protein DnaJ OS=Sinorhizobium medicae (strain WSM419) GN=dnaJ PE=3 SV=1 140 204 7.0E-12
sp|Q0AKB3|DNAJ_MARMM Chaperone protein DnaJ OS=Maricaulis maris (strain MCS10) GN=dnaJ PE=3 SV=1 140 204 8.0E-12
sp|B7VJX0|DNAJ_VIBTL Chaperone protein DnaJ OS=Vibrio tasmaniensis (strain LGP32) GN=dnaJ PE=3 SV=1 140 204 8.0E-12
sp|Q7N8Y3|DNAJ_PHOLL Chaperone protein DnaJ OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=dnaJ PE=3 SV=1 140 204 8.0E-12
sp|Q65U54|DNAJ_MANSM Chaperone protein DnaJ OS=Mannheimia succiniciproducens (strain MBEL55E) GN=dnaJ PE=3 SV=2 140 204 8.0E-12
sp|Q7UA76|DNAJ_SYNPX Chaperone protein DnaJ OS=Synechococcus sp. (strain WH8102) GN=dnaJ PE=3 SV=1 138 202 8.0E-12
sp|Q93R26|DNAJ_TETHA Chaperone protein DnaJ OS=Tetragenococcus halophilus GN=dnaJ PE=3 SV=1 140 204 8.0E-12
sp|Q47XI7|DNAJ_COLP3 Chaperone protein DnaJ OS=Colwellia psychrerythraea (strain 34H / ATCC BAA-681) GN=dnaJ PE=3 SV=1 140 204 9.0E-12
sp|C6BYN5|DNAJ_DESAD Chaperone protein DnaJ OS=Desulfovibrio salexigens (strain ATCC 14822 / DSM 2638 / NCIB 8403 / VKM B-1763) GN=dnaJ PE=3 SV=1 141 204 9.0E-12
sp|B9JZ89|DNAJ_AGRVS Chaperone protein DnaJ OS=Agrobacterium vitis (strain S4 / ATCC BAA-846) GN=dnaJ PE=3 SV=1 140 204 9.0E-12
sp|Q73IV4|DNAJ_WOLPM Chaperone protein DnaJ OS=Wolbachia pipientis wMel GN=dnaJ PE=3 SV=1 140 204 9.0E-12
sp|A9BNG6|DNAJ_DELAS Chaperone protein DnaJ OS=Delftia acidovorans (strain DSM 14801 / SPH-1) GN=dnaJ PE=3 SV=1 140 204 9.0E-12
sp|Q05646|DNAJ_ERYRH Chaperone protein DnaJ OS=Erysipelothrix rhusiopathiae GN=dnaJ PE=2 SV=1 140 204 9.0E-12
sp|B9MDJ8|DNAJ_ACIET Chaperone protein DnaJ OS=Acidovorax ebreus (strain TPSY) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|P9WNV7|DNAJ2_MYCTU Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=dnaJ2 PE=1 SV=1 140 207 1.0E-11
sp|P9WNV6|DNAJ2_MYCTO Chaperone protein DnaJ 2 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=dnaJ2 PE=3 SV=1 140 207 1.0E-11
sp|P63967|DNAJ2_MYCBO Chaperone protein DnaJ 2 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=dnaJ2 PE=3 SV=1 140 207 1.0E-11
sp|A4JBS2|DNAJ_BURVG Chaperone protein DnaJ OS=Burkholderia vietnamiensis (strain G4 / LMG 22486) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|A8GR21|DNAJ_RICRS Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Sheila Smith) GN=dnaJ PE=3 SV=1 141 206 1.0E-11
sp|Q8KRC9|DNAJ_MYXXA Chaperone protein DnaJ OS=Myxococcus xanthus GN=dnaJ PE=3 SV=1 140 208 1.0E-11
sp|Q3SIN3|DNAJ_THIDA Chaperone protein DnaJ OS=Thiobacillus denitrificans (strain ATCC 25259) GN=dnaJ PE=3 SV=1 140 208 1.0E-11
sp|B0BWH0|DNAJ_RICRO Chaperone protein DnaJ OS=Rickettsia rickettsii (strain Iowa) GN=dnaJ PE=3 SV=1 141 206 1.0E-11
sp|Q92T07|DNAJ_RHIME Chaperone protein DnaJ OS=Rhizobium meliloti (strain 1021) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|A1STE5|DNAJ_PSYIN Chaperone protein DnaJ OS=Psychromonas ingrahamii (strain 37) GN=dnaJ PE=3 SV=1 142 227 1.0E-11
sp|O84345|DNAJ_CHLTR Chaperone protein DnaJ OS=Chlamydia trachomatis (strain D/UW-3/Cx) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|B0BBX5|DNAJ_CHLTB Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2b (strain UCH-1/proctitis) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|Q3KM17|DNAJ_CHLTA Chaperone protein DnaJ OS=Chlamydia trachomatis serovar A (strain ATCC VR-571B / DSM 19440 / HAR-13) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|B0B7R0|DNAJ_CHLT2 Chaperone protein DnaJ OS=Chlamydia trachomatis serovar L2 (strain 434/Bu / ATCC VR-902B) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|Q98DD2|DNAJ_RHILO Chaperone protein DnaJ OS=Rhizobium loti (strain MAFF303099) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|O52065|DNAJ_MANHA Chaperone protein DnaJ OS=Mannheimia haemolytica GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|B1LZ52|DNAJ_METRJ Chaperone protein DnaJ OS=Methylobacterium radiotolerans (strain ATCC 27329 / DSM 1819 / JCM 2831) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|Q9PK53|DNAJ_CHLMU Chaperone protein DnaJ OS=Chlamydia muridarum (strain MoPn / Nigg) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|B1LCI2|DNAJ_THESQ Chaperone protein DnaJ OS=Thermotoga sp. (strain RQ2) GN=dnaJ PE=3 SV=1 140 247 1.0E-11
sp|Q9PB06|DNAJ_XYLFA Chaperone protein DnaJ OS=Xylella fastidiosa (strain 9a5c) GN=dnaJ PE=3 SV=1 140 248 1.0E-11
sp|Q9HJ83|DNAJ_THEAC Chaperone protein DnaJ OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=dnaJ PE=3 SV=1 140 248 1.0E-11
sp|Q8XIT1|DNAJ_CLOPE Chaperone protein DnaJ OS=Clostridium perfringens (strain 13 / Type A) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|Q12Q07|DNAJ_SHEDO Chaperone protein DnaJ OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|Q5NPS5|DNAJ_ZYMMO Chaperone protein DnaJ OS=Zymomonas mobilis subsp. mobilis (strain ATCC 31821 / ZM4 / CP4) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|O74752|MAS5_SCHPO Mitochondrial protein import protein mas5 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=mas5 PE=3 SV=1 137 204 1.0E-11
sp|Q6ME07|DNAJ_PARUW Chaperone protein DnaJ OS=Protochlamydia amoebophila (strain UWE25) GN=dnaJ PE=3 SV=1 138 204 1.0E-11
sp|Q5QXL2|DNAJ_IDILO Chaperone protein DnaJ OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|B0U3J7|DNAJ_XYLFM Chaperone protein DnaJ OS=Xylella fastidiosa (strain M12) GN=dnaJ PE=3 SV=1 140 248 1.0E-11
sp|Q1QET5|DNAJ_PSYCK Chaperone protein DnaJ OS=Psychrobacter cryohalolentis (strain K5) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|Q9WZV3|DNAJ_THEMA Chaperone protein DnaJ OS=Thermotoga maritima (strain ATCC 43589 / MSB8 / DSM 3109 / JCM 10099) GN=dnaJ PE=3 SV=1 140 247 1.0E-11
sp|Q0A7E4|DNAJ_ALKEH Chaperone protein DnaJ OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=dnaJ PE=3 SV=1 139 204 1.0E-11
sp|P78004|DNAJ_MYCPN Chaperone protein DnaJ OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=dnaJ PE=3 SV=1 140 265 1.0E-11
sp|Q3K3T1|DNAJ_STRA1 Chaperone protein DnaJ OS=Streptococcus agalactiae serotype Ia (strain ATCC 27591 / A909 / CDC SS700) GN=dnaJ PE=3 SV=1 139 255 1.0E-11
sp|Q4UJK6|DNAJ_RICFE Chaperone protein DnaJ OS=Rickettsia felis (strain ATCC VR-1525 / URRWXCal2) GN=dnaJ PE=3 SV=1 140 206 1.0E-11
sp|Q8L3D3|DNAJ_COLMA Chaperone protein DnaJ OS=Colwellia maris GN=dnaJ PE=3 SV=2 140 204 1.0E-11
sp|A5IIT4|DNAJ_THEP1 Chaperone protein DnaJ OS=Thermotoga petrophila (strain RKU-1 / ATCC BAA-488 / DSM 13995) GN=dnaJ PE=3 SV=1 140 247 1.0E-11
sp|B1KRT1|DNAJ_SHEWM Chaperone protein DnaJ OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=dnaJ PE=3 SV=1 140 204 1.0E-11
sp|O35723|DNJB3_MOUSE DnaJ homolog subfamily B member 3 OS=Mus musculus GN=Dnajb3 PE=2 SV=1 138 202 2.0E-11
sp|B2VGS0|DNAJ_ERWT9 Chaperone protein DnaJ OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|F1RTY8|DNJ5B_PIG DnaJ homolog subfamily C member 5B OS=Sus scrofa GN=DNAJC5B PE=3 SV=1 142 204 2.0E-11
sp|B7JY68|DNAJ_CYAP8 Chaperone protein DnaJ OS=Cyanothece sp. (strain PCC 8801) GN=dnaJ PE=3 SV=1 140 202 2.0E-11
sp|Q2KIJ8|DNJ5B_BOVIN DnaJ homolog subfamily C member 5B OS=Bos taurus GN=DNAJC5B PE=2 SV=1 142 204 2.0E-11
sp|Q92J37|DNAJ_RICCN Chaperone protein DnaJ OS=Rickettsia conorii (strain ATCC VR-613 / Malish 7) GN=dnaJ PE=3 SV=1 141 206 2.0E-11
sp|C3PMM6|DNAJ_RICAE Chaperone protein DnaJ OS=Rickettsia africae (strain ESF-5) GN=dnaJ PE=3 SV=1 141 206 2.0E-11
sp|Q83CJ2|CBPA_COXBU Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=cbpA PE=3 SV=1 136 248 2.0E-11
sp|A9NDK6|CBPA_COXBR Curved DNA-binding protein OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=cbpA PE=3 SV=1 136 248 2.0E-11
sp|A9KE65|CBPA_COXBN Curved DNA-binding protein OS=Coxiella burnetii (strain Dugway 5J108-111) GN=cbpA PE=3 SV=1 136 248 2.0E-11
sp|Q6HDK8|DNAJ_BACHK Chaperone protein DnaJ OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q81LS3|DNAJ_BACAN Chaperone protein DnaJ OS=Bacillus anthracis GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|C3L5R6|DNAJ_BACAC Chaperone protein DnaJ OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|C3P8L9|DNAJ_BACAA Chaperone protein DnaJ OS=Bacillus anthracis (strain A0248) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|A8F0U0|DNAJ_RICM5 Chaperone protein DnaJ OS=Rickettsia massiliae (strain Mtu5) GN=dnaJ PE=3 SV=1 141 206 2.0E-11
sp|B7JN38|DNAJ_BACC0 Chaperone protein DnaJ OS=Bacillus cereus (strain AH820) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q8RH03|DNAJ_FUSNN Chaperone protein DnaJ OS=Fusobacterium nucleatum subsp. nucleatum (strain ATCC 25586 / CIP 101130 / JCM 8532 / LMG 13131) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q634M8|DNAJ_BACCZ Chaperone protein DnaJ OS=Bacillus cereus (strain ZK / E33L) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|C1ESK7|DNAJ_BACC3 Chaperone protein DnaJ OS=Bacillus cereus (strain 03BB102) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|B9IY80|DNAJ_BACCQ Chaperone protein DnaJ OS=Bacillus cereus (strain Q1) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|B7HPL2|DNAJ_BACC7 Chaperone protein DnaJ OS=Bacillus cereus (strain AH187) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q730M2|DNAJ_BACC1 Chaperone protein DnaJ OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|B1ZGR2|DNAJ_METPB Chaperone protein DnaJ OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|C3K274|DNAJ_PSEFS Chaperone protein DnaJ OS=Pseudomonas fluorescens (strain SBW25) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q9HGM9|DNJC7_SCHPO DnaJ homolog subfamily C member 7 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC543.02c PE=3 SV=1 110 222 2.0E-11
sp|Q5YZX0|DNAJ1_NOCFA Chaperone protein DnaJ 1 OS=Nocardia farcinica (strain IFM 10152) GN=dnaJ1 PE=3 SV=1 140 207 2.0E-11
sp|A0KTS6|DNAJ_SHESA Chaperone protein DnaJ OS=Shewanella sp. (strain ANA-3) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
sp|Q0HY10|DNAJ_SHESR Chaperone protein DnaJ OS=Shewanella sp. (strain MR-7) GN=dnaJ PE=3 SV=1 140 204 2.0E-11
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 28 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091840
MESNKDEALRCLVIAEKYFSADNLTAARKFCSKSISLFGTPQAEKLLVRINEIDTNPSATSSPASASASSSSAKS
TSSADPGPSSTSATEEHPSVTGIKHRHQPQASSSSSNANGNQKKRDYTPEQHAVVKRVRACKVTEYYEILALKKD
CEENDVKKAYRKLALALHPDKNGAPGADEAFKLVSKAFQVLSDPQKRAVYDRSGGDPEDRFGGGGGDGMSSFFNQ
GGSRTQFDGEISPEELFNMFFGGGMGGPGATFTFGPGGPSVFTTSFGGPGGVFNNARRAGGNAQEASPRSLFLQL
LPIIILFGFSLLSALPSLFSTPPVPDPRFTFVSSTRYNAQRETGGLKIPYFVNQGEFQKHPVIGAELARDVSNVK
KGPALKKFENTVEQVYTRDLYAKCQYGMDRRTRRKENEIGLFGIGTDWEKVKKIEQEPIESCDELKRLGVI*
Coding >AgabiH97|091840
ATGGAGAGCAACAAGGACGAAGCTCTACGTTGTCTCGTAATTGCCGAGAAATACTTCAGCGCAGATAACTTAACT
GCTGCGCGCAAGTTCTGTTCCAAGTCCATTTCGCTATTCGGCACCCCTCAAGCGGAAAAGCTGCTGGTCAGGATA
AATGAAATTGATACCAACCCTTCTGCCACTTCCTCGCCTGCGAGTGCATCAGCTTCCTCTTCGTCAGCAAAGTCG
ACATCAAGTGCTGACCCGGGCCCGTCTTCAACCTCGGCGACGGAGGAGCACCCGTCTGTGACCGGTATAAAACAT
CGACACCAACCACAAGCATCGTCATCGTCGTCGAATGCAAACGGAAATCAGAAAAAAAGGGATTATACCCCAGAG
CAGCATGCAGTAGTCAAGAGAGTCCGAGCTTGCAAGGTTACAGAGTATTATGAGATCCTGGCTCTCAAGAAGGAT
TGCGAAGAGAATGATGTCAAGAAGGCATACCGAAAATTGGCACTTGCACTTCACCCCGACAAGAATGGAGCGCCT
GGGGCAGACGAGGCATTTAAATTGGTGTCGAAGGCGTTCCAAGTACTATCTGATCCACAAAAACGGGCGGTATAC
GATCGTAGCGGGGGGGATCCAGAAGATCGGTTCGGAGGTGGCGGTGGGGACGGAATGTCGTCCTTTTTCAATCAG
GGCGGAAGTCGAACACAATTCGACGGGGAAATCAGCCCCGAAGAACTATTTAATATGTTCTTTGGGGGTGGTATG
GGAGGACCTGGTGCCACATTTACTTTCGGTCCTGGGGGTCCAAGTGTCTTTACCACGAGTTTTGGAGGACCCGGA
GGAGTGTTCAACAATGCCAGAAGGGCGGGTGGAAACGCACAAGAAGCATCGCCACGGTCACTCTTTCTTCAACTC
CTACCTATCATCATTCTTTTCGGATTCTCACTCCTTTCAGCGTTACCCAGCCTGTTCAGTACGCCACCTGTGCCT
GATCCACGGTTCACGTTTGTGAGCTCGACACGCTACAATGCACAACGGGAAACGGGTGGGCTGAAAATTCCGTAT
TTTGTCAACCAGGGTGAATTTCAAAAGCACCCTGTGATTGGAGCTGAACTGGCACGGGATGTGTCCAATGTAAAG
AAAGGGCCGGCGTTGAAGAAATTTGAGAATACAGTGGAACAAGTGTACACGCGGGACTTGTATGCTAAATGCCAA
TATGGGATGGACCGGAGAACGAGGCGGAAGGAGAACGAAATTGGGCTGTTCGGTATAGGGACAGACTGGGAAAAG
GTGAAGAAAATCGAACAGGAGCCGATAGAGAGCTGCGATGAGTTGAAGCGACTTGGCGTTATCTGA
Transcript >AgabiH97|091840
ATGGAGAGCAACAAGGACGAAGCTCTACGTTGTCTCGTAATTGCCGAGAAATACTTCAGCGCAGATAACTTAACT
GCTGCGCGCAAGTTCTGTTCCAAGTCCATTTCGCTATTCGGCACCCCTCAAGCGGAAAAGCTGCTGGTCAGGATA
AATGAAATTGATACCAACCCTTCTGCCACTTCCTCGCCTGCGAGTGCATCAGCTTCCTCTTCGTCAGCAAAGTCG
ACATCAAGTGCTGACCCGGGCCCGTCTTCAACCTCGGCGACGGAGGAGCACCCGTCTGTGACCGGTATAAAACAT
CGACACCAACCACAAGCATCGTCATCGTCGTCGAATGCAAACGGAAATCAGAAAAAAAGGGATTATACCCCAGAG
CAGCATGCAGTAGTCAAGAGAGTCCGAGCTTGCAAGGTTACAGAGTATTATGAGATCCTGGCTCTCAAGAAGGAT
TGCGAAGAGAATGATGTCAAGAAGGCATACCGAAAATTGGCACTTGCACTTCACCCCGACAAGAATGGAGCGCCT
GGGGCAGACGAGGCATTTAAATTGGTGTCGAAGGCGTTCCAAGTACTATCTGATCCACAAAAACGGGCGGTATAC
GATCGTAGCGGGGGGGATCCAGAAGATCGGTTCGGAGGTGGCGGTGGGGACGGAATGTCGTCCTTTTTCAATCAG
GGCGGAAGTCGAACACAATTCGACGGGGAAATCAGCCCCGAAGAACTATTTAATATGTTCTTTGGGGGTGGTATG
GGAGGACCTGGTGCCACATTTACTTTCGGTCCTGGGGGTCCAAGTGTCTTTACCACGAGTTTTGGAGGACCCGGA
GGAGTGTTCAACAATGCCAGAAGGGCGGGTGGAAACGCACAAGAAGCATCGCCACGGTCACTCTTTCTTCAACTC
CTACCTATCATCATTCTTTTCGGATTCTCACTCCTTTCAGCGTTACCCAGCCTGTTCAGTACGCCACCTGTGCCT
GATCCACGGTTCACGTTTGTGAGCTCGACACGCTACAATGCACAACGGGAAACGGGTGGGCTGAAAATTCCGTAT
TTTGTCAACCAGGGTGAATTTCAAAAGCACCCTGTGATTGGAGCTGAACTGGCACGGGATGTGTCCAATGTAAAG
AAAGGGCCGGCGTTGAAGAAATTTGAGAATACAGTGGAACAAGTGTACACGCGGGACTTGTATGCTAAATGCCAA
TATGGGATGGACCGGAGAACGAGGCGGAAGGAGAACGAAATTGGGCTGTTCGGTATAGGGACAGACTGGGAAAAG
GTGAAGAAAATCGAACAGGAGCCGATAGAGAGCTGCGATGAGTTGAAGCGACTTGGCGTTATCTGA
Gene >AgabiH97|091840
ATGGAGAGCAACAAGGACGAAGCTCTACGTTGTCTCGTAATTGCCGAGAAATACTTCAGCGCAGATAACTTAACT
GCTGCGCGCAAGTTCTGTTCCAAGTCCATTTCGCTATTCGGCACCCCTCAAGCGGAAAAGCTGCTGGTCAGGATA
AATGAAATTGATACCAACCCTTCTGCCACTTCCTCGCCTGCGAGTGCATCAGCTTCCTCTTCGTCAGCAAAGTCG
ACATCAAGTGCTGACCCGGGCCCGTCTTCAACCTCGGCGACGGAGGAGCACCCGTCTGTGACCGGTATAAAACAT
CGACACCAACCACAAGCATCGTCATCGTCGTCGAATGCAAACGGAAATCAGAAAAAAAGGGATTATACCCCAGAG
CAGCATGCAGTAGTCAAGAGAGTCCGAGCTTGCAAGGTTACAGAGTATTATGAGATCCTGGCTCTCAAGAAGGAT
TGCGAAGAGAATGATGTCAAGAAGGCATACCGAAAAGTGCGTAGGCCTACATTTCTCATGCTATGTATTAAACAA
GATTTGTCTTTAGTTGGCACTTGCACTTCACCCCGACAAGAATGGAGCGCCTGGGGCAGACGAGGCATTTAAATG
TAGGTTTCAACTGTCTTCTGCTTTAAACTCTCAGTGCTGAGCATATCATTGGGCAGTGGTGTCGAAGGCGTTCCA
AGTACTATCTGGTAGGTGATCTTACTCTGACTCAAGGTCTCTTAGTAAATTGCGTTAGATCCACAAAAACGGGCG
GTATACGATCGTAGCGGGGGGGATCCAGAAGATCGGTTCGGAGGTGGCGGTGGGGACGGAATGTCGTCCTTTTTC
AATCAGGGCGGAAGTCGAACACAATTCGACGGGGAAATCAGCCCCGAAGAACTATTTAATATGTTCTTTGGGGGT
GGTATGGGAGGACCTGGTGCCACATTTACTTTCGGTCCTGGGGGTCCAAGTACGTATACATGTTATCAACGGCAT
CTCTTTGTCTTGACAAAGGATATCAAGGTGTCTTTACCACGAGTTTTGGAGGACCCGGAGGAGTGTTCAACAATG
CCAGAAGGGCGGGTGGAAACGCACAAGAAGCATCGCCACGGTCACTCTTTCTTCAACTCCTACCTATCATCATTC
TTTTCGGATTCTCACTCCTTTCAGCGTTACCCAGCCTGTTCAGTACGCCACCTGTGCCTGATCCACGGTTCACGT
TTGTGAGCTCGACACGCTACAATGCACAACGGGAAACGGGTGGGCTGAAAATTCCGTATTTTGTCAACCAGGGTG
AATTTCAAAAGCACCCTGTGATTGGAGCTGAACTGGCACGGGATGTGTCCAATGTAAAGAAAGGGCCGGCGTTGA
AGAAATTTGAGAATACAGTGGAACAAGTGTACACGCGGGACTTGTATGCTAAATGCCAATATGGGATGGACCGGA
GAACGAGGCGGAAGGAGAACGAAATTGGGCTGTTCGGTATAGGGACAGACTGGGAAAAGGTGAAGAAAATCGAAC
AGGAGCCGATAGAGAGCTGCGATGAGTTGAAGCGACTTGGCGTTATCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail