Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091810
Gene name
Locationscaffold_6:941488..945728
Strand-
Gene length (bp)4240
Transcript length (bp)3486
Coding sequence length (bp)3486
Protein length (aa) 1162

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF11865 DUF3385 Domain of unknown function (DUF3385) 7.4E-54 741 899

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 9 1161 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 16 1161 0.0E+00
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 16 1161 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 12 1161 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 58 1161 0.0E+00
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q86C65|TOR_DICDI Target of rapamycin OS=Dictyostelium discoideum GN=tor PE=1 SV=1 9 1161 0.0E+00
sp|O14356|TOR1_SCHPO Phosphatidylinositol 3-kinase tor1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor1 PE=1 SV=1 16 1161 0.0E+00
sp|Q9Y7K2|TOR2_SCHPO Phosphatidylinositol 3-kinase tor2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tor2 PE=1 SV=2 16 1161 0.0E+00
sp|P32600|TOR2_YEAST Serine/threonine-protein kinase TOR2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR2 PE=1 SV=3 12 1161 0.0E+00
sp|P35169|TOR1_YEAST Serine/threonine-protein kinase TOR1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TOR1 PE=1 SV=3 58 1161 0.0E+00
sp|Q9FR53|TOR_ARATH Serine/threonine-protein kinase TOR OS=Arabidopsis thaliana GN=TOR PE=1 SV=1 34 1161 0.0E+00
sp|Q0DJS1|TOR_ORYSJ Serine/threonine-protein kinase TOR OS=Oryza sativa subsp. japonica GN=TOR PE=2 SV=3 31 1161 0.0E+00
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 235 1161 0.0E+00
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 264 1161 0.0E+00
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 235 1161 0.0E+00
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 260 1161 1.0E-155
sp|Q95Q95|TOR_CAEEL Target of rapamycin homolog OS=Caenorhabditis elegans GN=let-363 PE=2 SV=3 20 1103 3.0E-74
sp|P42346|MTOR_RAT Serine/threonine-protein kinase mTOR OS=Rattus norvegicus GN=Mtor PE=1 SV=1 12 277 6.0E-38
sp|Q9JLN9|MTOR_MOUSE Serine/threonine-protein kinase mTOR OS=Mus musculus GN=Mtor PE=1 SV=2 12 277 7.0E-38
sp|P42345|MTOR_HUMAN Serine/threonine-protein kinase mTOR OS=Homo sapiens GN=MTOR PE=1 SV=1 12 277 7.0E-38
sp|Q9VK45|TOR_DROME Target of rapamycin OS=Drosophila melanogaster GN=Tor PE=1 SV=1 18 269 2.0E-27
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091810
MAPNVQAPAEKLSTIFTGLKNRNADVRVQNAKELRRFVLTEVADMSSDASVKIWDETINRKLFELTHSQNTAEAY
GGLMAIDYLLGTEPDETIEAKRNLFRFYNYVKHLLPNHEVSLMLYASKTLGRIAEIGGSAFGERFMDYEVQAAID
LIQPDKNESPRHAGVLILKELARNSPTYFHQHIDVVFENILIPLRDPRVHIREGAAELLAACLEIITTRERQTRS
PYFSKILQDAHQGLKGSSMDIVHGSLLTYRELLLHAGMFMKESYLDITEQILRYKSHRDPLIRKMVITMIPSLAV
YDTQTFTEHFLHKAMGHLLTQLEKPAERNYAFIAIGHTANAIGSDMKPFLDSIMNQIKIGLQGRGRKNAPNEEPL
FQCMGMLAAAVGPNLTKLLHDQLDLMMSCGLSEPLKNALAIIAKHIPPLLQTIQDRLLDLLSQVLSGQPYKSLGA
PTPTVRQDNTGIMSNVPPQASHDKSPELITLALTTLGSFDFNGHVLNEFVRNCAVPYLEDDQPEVRRAAALTCCR
LLVCDPICYQSSSHAIEIISDVLDKLLTVGIADPDSSIRQTVLGALHEKFDKHLAQAENVRSLFIALNDEVFENR
MIAVGLIGRLARHNPAYVMPSLRKALIQLLTELEYSTVLRSREECTRLLTLLVSCTQRFIKPYALPILRVMLQKA
NDVNPTISANVLMCLGELVSIAGEDALIYVPDMMAIIIQRLSDPSVIKRDAALHALGQLCSSTGYVITPLVDYPQ
LVPLLSSILRSDGAKNMRREVVKVLGILGALDPYRRKTRPDDESMSEKVATAVNQVPAVQFNTVSGADDYFQMVV
INALLAILKDQALSSHHHTVIDAVMSIFKTQGLKCVAFLPQIIPAFTSVARTASVARLQEFHLQQLAILVGIIKQ
QVRNYMPEIFALITELWEHSALQLPIVVLIEALGIALDAEFKPFLPTILSLILKVFEGGPPDDKRSSVQIKVFDA
FLTFGSNIEEYLHLVIPIIVKTYERDGSTQLRKKAVQTINGLARSVNFSDHASRIIHPLVRVLDNSNTELRISVM
EALCSLMMQLGADFAIFVPTINKSIMRNKVVPHHVYENMINKLLNGEPLPQDMALQDSLEPNKITEFSAPAEASK
MTVNQQHLKQAWDVSLVATREDWFEWIHRLSVEFMK*
Coding >AgabiH97|091810
ATGGCGCCTAATGTCCAGGCGCCAGCAGAGAAGCTCTCCACCATTTTTACTGGCCTCAAGAACCGCAATGCTGAT
GTTCGTGTGCAGAATGCTAAGGAATTGCGTCGTTTTGTTTTAACAGAGGTGGCCGATATGTCTTCAGATGCATCG
GTCAAAATCTGGGATGAGACTATAAACAGAAAGCTCTTTGAGTTGACGCATAGCCAGAATACAGCGGAGGCATAT
GGTGGTTTGATGGCAATAGACTATCTCCTCGGTACCGAGCCTGACGAGACTATTGAAGCAAAGCGGAATCTTTTC
CGATTCTACAACTATGTTAAGCATTTATTGCCCAATCATGAAGTTTCCCTCATGCTGTATGCATCGAAAACGCTT
GGTCGCATAGCAGAAATTGGGGGTTCTGCTTTTGGAGAAAGATTCATGGACTACGAGGTTCAAGCTGCTATCGAC
CTGATACAACCTGATAAGAACGAGTCTCCTCGCCATGCCGGTGTTTTAATTCTGAAAGAATTGGCTCGCAACAGT
CCCACATACTTTCACCAGCACATAGATGTTGTATTCGAGAACATTCTTATTCCTCTACGTGACCCTCGGGTCCAT
ATTCGTGAAGGAGCGGCAGAATTATTGGCAGCGTGCCTTGAAATAATTACCACTCGAGAGCGCCAAACGAGGAGT
CCTTACTTCTCCAAAATACTTCAAGATGCTCATCAAGGCCTCAAGGGAAGCTCAATGGATATTGTGCATGGTTCA
CTATTGACGTATCGCGAGTTATTACTTCACGCGGGAATGTTCATGAAGGAGAGTTACCTTGATATCACTGAACAA
ATCCTTCGTTACAAGTCACATCGAGATCCCCTCATACGCAAAATGGTGATAACGATGATTCCATCCTTGGCTGTT
TACGACACACAGACCTTCACCGAACATTTCCTGCACAAAGCGATGGGTCACCTTTTGACGCAATTGGAAAAGCCC
GCTGAGCGGAATTATGCATTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTA
GACTCTATCATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGACGCAAGAATGCACCAAACGAAGAGCCGCTC
TTCCAATGTATGGGAATGTTGGCGGCAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTC
ATGATGAGCTGCGGGTTGAGTGAGCCCTTGAAGAATGCACTTGCTATCATTGCGAAACACATACCTCCCTTGCTT
CAAACAATTCAAGATCGATTACTGGATCTCCTGTCGCAGGTTTTAAGTGGACAACCATACAAGTCTTTGGGAGCG
CCTACGCCTACCGTTAGACAAGATAATACTGGTATCATGTCCAATGTCCCCCCTCAAGCATCTCACGACAAAAGC
CCTGAATTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAACGGGCACGTACTCAATGAATTTGTG
CGGAATTGTGCAGTTCCTTATCTCGAAGACGACCAACCCGAAGTTCGCCGAGCAGCTGCATTGACTTGCTGTCGA
CTTCTTGTTTGCGATCCTATTTGCTATCAGTCAAGCAGCCATGCCATTGAGATCATCAGCGACGTACTAGACAAA
CTGTTAACAGTGGGCATCGCTGATCCTGATTCGTCGATTCGGCAGACGGTACTTGGTGCTCTACATGAAAAGTTT
GACAAACACTTGGCACAGGCAGAGAATGTTCGCTCACTGTTCATTGCTTTAAATGATGAGGTATTTGAAAACCGC
ATGATTGCGGTGGGTCTTATTGGGCGGCTAGCAAGACATAACCCGGCCTATGTGATGCCATCCCTGCGTAAAGCG
TTGATTCAGCTCTTAACCGAGCTCGAATACTCGACTGTGCTTCGAAGTCGCGAGGAATGCACGCGGTTGCTAACG
CTGCTGGTAAGCTGTACGCAGCGATTTATCAAACCTTACGCCCTACCCATACTTCGGGTCATGTTACAAAAAGCA
AATGACGTCAATCCGACTATTTCTGCCAATGTTCTTATGTGCCTAGGGGAGCTAGTTAGCATTGCTGGAGAAGAT
GCCCTTATTTACGTACCTGATATGATGGCAATAATCATTCAAAGGCTTTCGGATCCATCGGTCATCAAGAGGGAT
GCTGCGCTACATGCTTTGGGGCAATTATGCTCTAGCACGGGCTATGTCATCACTCCCTTAGTGGATTATCCACAG
CTAGTGCCCCTTCTGTCTAGTATTCTGAGATCGGACGGAGCTAAAAATATGAGGCGGGAAGTAGTGAAAGTGTTG
GGTATTCTTGGCGCGCTGGATCCGTATAGGCGGAAGACGCGACCTGATGACGAGTCCATGAGCGAGAAGGTGGCC
ACTGCTGTCAATCAAGTACCGGCGGTACAGTTCAACACAGTTTCAGGGGCCGATGACTACTTCCAAATGGTGGTC
ATCAACGCTCTTCTTGCCATTCTTAAGGACCAGGCTTTAAGTAGTCATCATCATACCGTGATTGACGCTGTTATG
TCCATCTTCAAGACCCAGGGTTTGAAATGCGTCGCTTTCTTACCACAGATAATTCCTGCCTTCACTTCCGTTGCT
CGCACTGCTTCTGTTGCTCGGTTGCAGGAGTTCCATCTACAACAACTCGCCATTCTGGTTGGAATCATCAAGCAA
CAGGTCCGAAATTACATGCCAGAAATCTTCGCCCTGATTACTGAACTTTGGGAACATTCAGCTCTTCAGCTCCCT
ATTGTAGTTTTAATAGAAGCTCTGGGTATAGCTCTTGATGCCGAATTCAAGCCATTCCTTCCTACTATCCTCTCC
CTCATCCTCAAAGTCTTTGAAGGAGGTCCTCCTGACGACAAACGAAGTTCTGTCCAAATCAAGGTCTTCGATGCG
TTCCTTACCTTCGGCTCGAACATCGAAGAATACCTTCATCTCGTGATACCGATTATTGTGAAGACATATGAGCGC
GATGGTAGCACTCAGCTTCGTAAGAAAGCCGTTCAAACGATCAATGGGTTGGCACGTAGTGTTAACTTCTCTGAT
CACGCATCCCGCATCATCCATCCTTTGGTTCGAGTGCTGGACAATTCCAATACGGAGCTCAGAATATCAGTCATG
GAGGCTTTATGTTCTTTGATGATGCAACTTGGAGCCGATTTTGCCATTTTTGTTCCCACTATCAATAAAAGCATC
ATGCGAAACAAGGTCGTCCCTCATCATGTGTATGAAAACATGATCAACAAACTTCTGAATGGCGAACCACTTCCT
CAGGATATGGCCCTACAGGATTCGCTTGAGCCGAACAAAATCACAGAATTTTCTGCCCCTGCTGAAGCAAGCAAA
ATGACTGTCAATCAGCAACATCTTAAGCAAGCGTGGGACGTATCTCTGGTTGCTACCCGAGAAGACTGGTTTGAG
TGGATTCACCGGCTTAGTGTTGAGTTCATGAAATAA
Transcript >AgabiH97|091810
ATGGCGCCTAATGTCCAGGCGCCAGCAGAGAAGCTCTCCACCATTTTTACTGGCCTCAAGAACCGCAATGCTGAT
GTTCGTGTGCAGAATGCTAAGGAATTGCGTCGTTTTGTTTTAACAGAGGTGGCCGATATGTCTTCAGATGCATCG
GTCAAAATCTGGGATGAGACTATAAACAGAAAGCTCTTTGAGTTGACGCATAGCCAGAATACAGCGGAGGCATAT
GGTGGTTTGATGGCAATAGACTATCTCCTCGGTACCGAGCCTGACGAGACTATTGAAGCAAAGCGGAATCTTTTC
CGATTCTACAACTATGTTAAGCATTTATTGCCCAATCATGAAGTTTCCCTCATGCTGTATGCATCGAAAACGCTT
GGTCGCATAGCAGAAATTGGGGGTTCTGCTTTTGGAGAAAGATTCATGGACTACGAGGTTCAAGCTGCTATCGAC
CTGATACAACCTGATAAGAACGAGTCTCCTCGCCATGCCGGTGTTTTAATTCTGAAAGAATTGGCTCGCAACAGT
CCCACATACTTTCACCAGCACATAGATGTTGTATTCGAGAACATTCTTATTCCTCTACGTGACCCTCGGGTCCAT
ATTCGTGAAGGAGCGGCAGAATTATTGGCAGCGTGCCTTGAAATAATTACCACTCGAGAGCGCCAAACGAGGAGT
CCTTACTTCTCCAAAATACTTCAAGATGCTCATCAAGGCCTCAAGGGAAGCTCAATGGATATTGTGCATGGTTCA
CTATTGACGTATCGCGAGTTATTACTTCACGCGGGAATGTTCATGAAGGAGAGTTACCTTGATATCACTGAACAA
ATCCTTCGTTACAAGTCACATCGAGATCCCCTCATACGCAAAATGGTGATAACGATGATTCCATCCTTGGCTGTT
TACGACACACAGACCTTCACCGAACATTTCCTGCACAAAGCGATGGGTCACCTTTTGACGCAATTGGAAAAGCCC
GCTGAGCGGAATTATGCATTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTA
GACTCTATCATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGACGCAAGAATGCACCAAACGAAGAGCCGCTC
TTCCAATGTATGGGAATGTTGGCGGCAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTC
ATGATGAGCTGCGGGTTGAGTGAGCCCTTGAAGAATGCACTTGCTATCATTGCGAAACACATACCTCCCTTGCTT
CAAACAATTCAAGATCGATTACTGGATCTCCTGTCGCAGGTTTTAAGTGGACAACCATACAAGTCTTTGGGAGCG
CCTACGCCTACCGTTAGACAAGATAATACTGGTATCATGTCCAATGTCCCCCCTCAAGCATCTCACGACAAAAGC
CCTGAATTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAACGGGCACGTACTCAATGAATTTGTG
CGGAATTGTGCAGTTCCTTATCTCGAAGACGACCAACCCGAAGTTCGCCGAGCAGCTGCATTGACTTGCTGTCGA
CTTCTTGTTTGCGATCCTATTTGCTATCAGTCAAGCAGCCATGCCATTGAGATCATCAGCGACGTACTAGACAAA
CTGTTAACAGTGGGCATCGCTGATCCTGATTCGTCGATTCGGCAGACGGTACTTGGTGCTCTACATGAAAAGTTT
GACAAACACTTGGCACAGGCAGAGAATGTTCGCTCACTGTTCATTGCTTTAAATGATGAGGTATTTGAAAACCGC
ATGATTGCGGTGGGTCTTATTGGGCGGCTAGCAAGACATAACCCGGCCTATGTGATGCCATCCCTGCGTAAAGCG
TTGATTCAGCTCTTAACCGAGCTCGAATACTCGACTGTGCTTCGAAGTCGCGAGGAATGCACGCGGTTGCTAACG
CTGCTGGTAAGCTGTACGCAGCGATTTATCAAACCTTACGCCCTACCCATACTTCGGGTCATGTTACAAAAAGCA
AATGACGTCAATCCGACTATTTCTGCCAATGTTCTTATGTGCCTAGGGGAGCTAGTTAGCATTGCTGGAGAAGAT
GCCCTTATTTACGTACCTGATATGATGGCAATAATCATTCAAAGGCTTTCGGATCCATCGGTCATCAAGAGGGAT
GCTGCGCTACATGCTTTGGGGCAATTATGCTCTAGCACGGGCTATGTCATCACTCCCTTAGTGGATTATCCACAG
CTAGTGCCCCTTCTGTCTAGTATTCTGAGATCGGACGGAGCTAAAAATATGAGGCGGGAAGTAGTGAAAGTGTTG
GGTATTCTTGGCGCGCTGGATCCGTATAGGCGGAAGACGCGACCTGATGACGAGTCCATGAGCGAGAAGGTGGCC
ACTGCTGTCAATCAAGTACCGGCGGTACAGTTCAACACAGTTTCAGGGGCCGATGACTACTTCCAAATGGTGGTC
ATCAACGCTCTTCTTGCCATTCTTAAGGACCAGGCTTTAAGTAGTCATCATCATACCGTGATTGACGCTGTTATG
TCCATCTTCAAGACCCAGGGTTTGAAATGCGTCGCTTTCTTACCACAGATAATTCCTGCCTTCACTTCCGTTGCT
CGCACTGCTTCTGTTGCTCGGTTGCAGGAGTTCCATCTACAACAACTCGCCATTCTGGTTGGAATCATCAAGCAA
CAGGTCCGAAATTACATGCCAGAAATCTTCGCCCTGATTACTGAACTTTGGGAACATTCAGCTCTTCAGCTCCCT
ATTGTAGTTTTAATAGAAGCTCTGGGTATAGCTCTTGATGCCGAATTCAAGCCATTCCTTCCTACTATCCTCTCC
CTCATCCTCAAAGTCTTTGAAGGAGGTCCTCCTGACGACAAACGAAGTTCTGTCCAAATCAAGGTCTTCGATGCG
TTCCTTACCTTCGGCTCGAACATCGAAGAATACCTTCATCTCGTGATACCGATTATTGTGAAGACATATGAGCGC
GATGGTAGCACTCAGCTTCGTAAGAAAGCCGTTCAAACGATCAATGGGTTGGCACGTAGTGTTAACTTCTCTGAT
CACGCATCCCGCATCATCCATCCTTTGGTTCGAGTGCTGGACAATTCCAATACGGAGCTCAGAATATCAGTCATG
GAGGCTTTATGTTCTTTGATGATGCAACTTGGAGCCGATTTTGCCATTTTTGTTCCCACTATCAATAAAAGCATC
ATGCGAAACAAGGTCGTCCCTCATCATGTGTATGAAAACATGATCAACAAACTTCTGAATGGCGAACCACTTCCT
CAGGATATGGCCCTACAGGATTCGCTTGAGCCGAACAAAATCACAGAATTTTCTGCCCCTGCTGAAGCAAGCAAA
ATGACTGTCAATCAGCAACATCTTAAGCAAGCGTGGGACGTATCTCTGGTTGCTACCCGAGAAGACTGGTTTGAG
TGGATTCACCGGCTTAGTGTTGAGTTCATGAAATAA
Gene >AgabiH97|091810
ATGGCGCCTAATGTCCAGGCGCCAGCAGAGAAGCTCTCCACCATTTTTACTGGCCTCAAGAACCGCAATGCTGAT
GTTCGTGTGCAGAATGCTAAGGAATTGCGTCGTTTTGTAGGTTTGACTCTGACACTCGACATTACATCTACTGAC
TATGAAGTTGTGTAGGTTTTAACAGAGGTGGCCGATATGTCTTCAGATGCATCGGTCAAAATCTGGGATGAGACT
ATAAACAGAAAGCTCTTTGAGTTGACGCATAGCCAGAATACAGCGGAGGCATATGGTGGTTTGATGGCAATAGGT
GCGTAACTGGAGGCTCTTCAAGCTTTCTACTTTGTTTAATTTGCAGTAGACTATCTCCTCGGTACCGAGCCTGAC
GAGACTATTGAAGCAAAGCGGAATCTTTTCCGATTCTACAACTATGTTAAGCATTTATTGCCCAATCATGAAGTT
TCCCTCATGCTGTATGCATCGAAAACGCTTGGTCGCATAGCAGAAATTGGGGGTTCTGCTTTTGGAGAAAGATTC
ATGGACTACGAGGTTCAAGCTGCTATCGACCTGATACAACCTGATAAGAACGAGTCTCCTCGCCATGCCGGTGTT
TTAATTCTGAAAGAATTGGCTCGCAACAGTCCCACATACTTTCACCAGCACATAGATGTTGTATTCGAGAACATT
CTTATTCCTCTACGTGACCCTCGGGTCCATATTCGTGAAGGAGCGGCAGAATTATTGGCAGCGTGCCTTGAAATA
ATTACCACTCGAGAGCGCCAAACGAGGAGTCCTTACTTCTCCAAAATACTTCAAGATGCTCATCAAGGCCTCAAG
GGAAGCTCAATGGATATTGTGCATGGTTCACTATTGACGTATCGCGAGTTATTACTTCACGCGGGAATGGTGGGT
CCTTGAATCACCTTAAATGCCAGAAGTTTGACTGAGCTTCATTTCAAAGTTCATGAAGGAGAGTTACCTTGATAT
CACTGAACAAATCCTTCGTTACAAGTCACATCGAGATCCCCTCATACGCAAAATGGTGATAACGATGATTCCATC
CTTGGCTGTTTACGACACACAGACCTTCACCGAACATTTCCTGCACAAAGCGATGGGTCACCTTTTGACGCAATT
GGAAAAGCCCGCTGAGCGGAATTATGGTAAGAGCAAATCATTATCTCTTGAAACTGCTTTGGTTGTAATTCTAAT
GATTTTCCAGCATTCATTGCTATTGGGCACACTGCTAATGCTATTGGAAGTGACATGAAGCCGTTCCTAGACTCT
ATCATGAATCAGATCAAAATTGGTTTGCAAGGCAGAGGGTGAGTGTATGTCGTTCCGTGGAACCCTGCAGAGTTC
TAAATACATATCTGTCAAGACGCAAGAATGCACCAAACGAAGAGCCGCTCTTCCAATGTATGGGAATGTTGGCGG
CAGCTGTAGGACCAAATTTGACAAAGTTGCTACATGACCAACTTGACCTCATGATGAGCTGCGGGTTGAGTGAGC
CCTTGAAGAATGCACTTGCTATCATTGCGAAACACATACCTCCCTTGCTTCAAACAATTCAAGGTGGGCGGTTTA
AGGCTTAAATCATGAAAATTACTCACAGATCCTGAGAAGATCGATTACTGGATCTCCTGTCGCAGGTTTTAAGTG
GACAACCATACAAGTCTTTGGGAGCGCCTACGCCTACCGTTAGACAAGATAATACTGGTATCATGTCCAATGTCC
CCCCTCAAGTGAGTGCTTCTGTGCGTCCTAAGTTTGTGGTTTAATCTGACTTTGAGAAGGCATCTCACGACAAAA
GCCCTGAATTGATTACTCTTGCCCTCACAACACTTGGCTCCTTTGATTTCAACGGTCAGTGCTGCATACTCTGCC
CTGTGCCTAGTTGCTGAAAGAGAACCCCGCCATGGTCAGGGCACGTACTCAATGAATTTGTGCGGAATTGTGCAG
TTCCTTATCTCGAAGACGACCAACCCGAAGTTCGCCGAGCAGCTGCATTGACTTGCTGTCGACTTCTTGTTTGCG
ATCCTATTTGCTATCAGTCAAGCAGCCATGCCATTGAGATCATCAGCGACGTACTAGACAAACTGTTAACAGTGG
GCATCGCTGATCCTGGTATACCTATTGACCTTCCACCATGGAATGATACACTGATTTATCATTCTTTGTAGATTC
GTCGATTCGGCAGACGGTACTTGGTGCTCTACATGAAAAGTTTGACAAACACTTGGCACAGGCAGAGAATGTTCG
CTCACTGTTCATTGCTTTAAATGATGAGGTATTTGAAAACCGCATGATTGCGGTGGGTCTTATTGGGCGGCTAGC
AAGACATAACCCGGCCTATGTGATGCCATCCCTGCGTAAAGCGTTGATTCAGCTCTTAACCGAGCTCGAATACTC
GACTGTGCTGTATGTCTCTTTCGTATCTGAGCACTTTGGTACACTCATTGACCATTTGAAGTCGAAGTCGCGAGG
AATGCACGCGGTTGCTAACGCTGCTGGTAAGCTGTACGCAGCGATTTATCAAACCTTACGCCCTACCCATACTTC
GGGTCATGTTACAAAAAGCAAATGACGTCAATCCGACTATTTCTGCCAATGTTCTTATGTGCCTAGGGGAGCTAG
TTAGCATTGCTGGAGAAGATGCCCTTATTTACGTACCTGATATGATGGCAATAATCATTCAAAGGCTTTCGGATC
CATCGGTCATCAAGAGGGATGCTGCGCTACATGCTTTGGGGCAATTATGCTCTAGCACGGGCTATGTCATCACTC
CCTTAGTGGATTATCCACAGCTAGTGCCCCTTCTGTCTAGTATTCTGAGATCGGACGGAGCTAAAAATATGAGGC
GGGAAGTAGTGAAAGTGTTGGGTATTCTTGGCGCGCTGGATCCGTATAGGCGGAAGGTAAGGAGTGTTCCTCAGA
TTTATGCTATCACTCACTCATGGTATGACCAGACGCGACCTGATGACGAGTCCATGAGCGAGAAGGTGGCCACTG
CTGTCAATCAAGTACCGGCGGTACAGTTCAACACAGTTTCAGGGGCCGATGACTACTTCCAAATGGTGGTCATCA
ACGCTCTTCTTGCCATTCTTAAGGACCAGGCTTTAAGTAGTCATCATCATACCGTGATTGACGCTGTTATGTCCA
TCTTCAAGACCCAGGGTTTGAAATGCGTCGCTTTCTTACCACAGGTATGTTGGTCAAGCTTTTGAAAGTGACTAT
TCTTATACATATCGATGTTTAGATAATTCCTGCCTTCACTTCCGTTGCTCGCACTGCTTCTGTTGCTCGGTTGCA
GGAGTTCCATCTACAACAACTCGCCATTCTGGTTGGAATCATCAAGCAACAGGTCCGAAATTACATGCCAGAAAT
CTTCGCCCTGATTACTGAACTTTGGGAACATTCAGCTCTTCAGCTCCCTATTGTAGTTTTAATAGAAGCTCTGGG
TATAGCTCTTGATGCCGAATTCAAGCCATTCCTTCCTACTATCCTCTCCCTCATCCTCAAAGTCTTTGAAGGAGG
TCCTCCTGACGACAAACGAAGTTCTGTCCAAATCAAGGTCTTCGATGCGTTCCTTACCTTCGGCTCGAACATCGA
AGAATACCTTCATCTCGTGATACCGATTATTGTGAAGACATATGAGCGCGATGGTAGCACTCAGCTTCGTAAGAA
AGCCGTTCAAACGATCAATGGGTTGGCACGTAGTGTTAACTTCTCTGATCACGCATCCCGCATCATCCATCCTTT
GGTTCGAGTGCTGGACAATTCCAATACGGAGCTCAGAATATCAGTCATGGAGGCTTTATGTTCTTTGATGATGCA
ACTTGGAGCCGATTTTGCCATTTTTGTTCCCACTATCAATAAAGTATGCTTTCCCCCTCTCTCGTATCCCTTTCA
ACTTGACTGATCTCATGACAGAGCATCATGCGAAACAAGGTCGTCCCTCATCATGTGTATGAAAACATGATCAAC
AAACTTCTGAATGGCGAACCACTTCCTCAGGATATGGCCCTACAGGATTCGCTGTGAGTGTGCACTCAGGTCAAA
CAGTATCGGGTATCTAATTTTTCTTGTTAGTGAGCCGAACAAAATCACAGAATTTTCTGCCCCTGCTGAAGCAAG
CAAAATGACTGTCAATCAGCAACATCTTAAGCAAGCGTGGGACGTATCTCTGGTTGCTACCCGAGAAGACTGGTT
TGAGTGGATTCACCGGCTTAGTGTTGAGTTCATGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail