Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091750
Gene name
Locationscaffold_6:916034..918998
Strand-
Gene length (bp)2964
Transcript length (bp)2289
Coding sequence length (bp)2289
Protein length (aa) 763

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF16457 PH_12 Pleckstrin homology domain 2.2E-33 564 703
PF11841 ELMO_ARM ELMO, armadillo-like helical domain 4.0E-26 135 313
PF04727 ELMO_CED12 ELMO/CED-12 family 2.3E-23 338 495

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 43 750 8.0E-39
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 43 750 1.0E-38
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 43 750 4.0E-31
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 43 750 2.0E-30
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 43 751 2.0E-30
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92556|ELMO1_HUMAN Engulfment and cell motility protein 1 OS=Homo sapiens GN=ELMO1 PE=1 SV=2 43 750 8.0E-39
sp|Q8BPU7|ELMO1_MOUSE Engulfment and cell motility protein 1 OS=Mus musculus GN=Elmo1 PE=1 SV=2 43 750 1.0E-38
sp|Q96JJ3|ELMO2_HUMAN Engulfment and cell motility protein 2 OS=Homo sapiens GN=ELMO2 PE=1 SV=2 43 750 4.0E-31
sp|Q5RCC1|ELMO2_PONAB Engulfment and cell motility protein 2 OS=Pongo abelii GN=ELMO2 PE=2 SV=1 43 750 2.0E-30
sp|A4FUD6|ELMO2_BOVIN Engulfment and cell motility protein 2 OS=Bos taurus GN=ELMO2 PE=2 SV=1 43 751 2.0E-30
sp|Q96BJ8|ELMO3_HUMAN Engulfment and cell motility protein 3 OS=Homo sapiens GN=ELMO3 PE=1 SV=3 42 733 4.0E-29
sp|Q8BHL5|ELMO2_MOUSE Engulfment and cell motility protein 2 OS=Mus musculus GN=Elmo2 PE=1 SV=1 43 751 7.0E-29
sp|Q8BYZ7|ELMO3_MOUSE Engulfment and cell motility protein 3 OS=Mus musculus GN=Elmo3 PE=1 SV=2 42 733 1.0E-28
sp|Q499U2|ELMO3_RAT Engulfment and cell motility protein 3 OS=Rattus norvegicus GN=Elmo3 PE=2 SV=1 42 733 4.0E-27
sp|A6QR40|ELMO3_BOVIN Engulfment and cell motility protein 3 OS=Bos taurus GN=ELMO3 PE=2 SV=1 42 647 1.0E-24
sp|Q54YW1|ELMOA_DICDI ELMO domain-containing protein A OS=Dictyostelium discoideum GN=elmoA PE=1 SV=1 121 509 7.0E-10
sp|A8XEZ1|CED12_CAEBR Cell death abnormality protein 12 OS=Caenorhabditis briggsae GN=ced-12 PE=3 SV=3 70 758 9.0E-10
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 49 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091750
MSAGGASSSSRVSGLPSSTPKAPPLVPTNHVTTLEGVTVRARIDPTLTVDDVLKQLCSSLKKEPASDFALRDESD
ELVTNDNLRKKIKGRVGLKLVKSPSRQAADTVEELQTREENDGKLRMALFELQKFIREEQFVQEFLKYGGLHMLV
NHISIASRNSLAYALTSMQNLMDFDYGWGSLDDNFILRVVQILSSSQSPINVCRPATVILKKLVEADPLSAPGTL
ASTSKGPPALPPGSVYRYGFQVVFNQMKKERGLLGTVVDRLGSADTAMAQYSMMLINSLLSHANDDGWEEFVAEL
EQLNIRQAFIRSMSLHTIEDLTSCILDFQANMVRVTYRKKTTLVDPEHVPAHNDALSYIWNNSQLEVDEDDLGGI
VQWRKLGFESEDIVQEFSEVGVLGLDCLRNFVETDPDFSKLVLEQSSRPEDRRCPLGKASNEVVELLSVYWNIFE
PGYSTSTTFQPFFLDFYRVHFLATRFFLRMWGESGAAIGDFQRVLDLVQSQVKVALRSESVRPWREVEQEFNQSD
YRAVRDRQMKELELEDDLLNKVPVRNLRAKLYKESYEFVRQQRIQCLLQGAWFVIALPQNAPREVVRRPKRPWRF
MRLDSGLKYLHYVDSAVKFPVRSGLEDLPDRIDVSLINDIATGTCAPPPNVLRGDDDLPPAGVLSPSPLSFSLLN
AHEGSLVDLIAPDQSRWADWTDGLNMLRKDGGHAPSTETSSFVQALTEIGLKIKLLDLSGEMVEIPTNLTAGPPP
TDTNFFFSESLL*
Coding >AgabiH97|091750
ATGTCCGCTGGTGGTGCATCCTCTTCCTCCAGGGTTTCTGGCCTTCCAAGCAGCACGCCGAAAGCACCTCCGCTT
GTACCCACAAACCACGTCACTACGCTGGAGGGCGTTACTGTCCGCGCTCGGATAGATCCAACCTTGACTGTAGAT
GACGTGTTGAAGCAACTGTGCTCTAGCCTCAAAAAAGAACCTGCTTCTGATTTTGCGTTGAGGGATGAATCAGAC
GAGCTTGTGACCAATGATAATTTGAGGAAGAAGATCAAGGGAAGAGTGGGTCTGAAACTTGTCAAATCGCCGTCA
CGTCAGGCCGCCGATACAGTAGAGGAGCTTCAAACCAGAGAGGAGAATGACGGCAAGTTGAGGATGGCTTTATTC
GAGCTGCAAAAATTCATTCGGGAGGAGCAATTTGTTCAAGAATTCCTCAAATACGGCGGCTTGCACATGTTGGTG
AATCATATATCCATTGCTTCACGCAATTCACTTGCTTACGCGCTTACTTCGATGCAAAATCTAATGGACTTTGAC
TACGGCTGGGGGAGTCTGGATGACAACTTCATCCTACGCGTAGTTCAGATACTTTCTTCATCTCAGTCGCCTATC
AACGTCTGTCGACCCGCAACGGTTATTCTTAAAAAGCTTGTCGAGGCCGATCCTCTAAGTGCGCCGGGAACGCTA
GCAAGCACTAGTAAAGGTCCCCCTGCACTTCCTCCCGGTTCTGTGTACCGTTACGGTTTCCAGGTCGTGTTTAAT
CAGATGAAAAAAGAACGGGGACTCTTAGGGACAGTAGTAGATCGTCTCGGAAGTGCAGACACAGCGATGGCTCAG
TACAGCATGATGCTCATTAACTCCCTTCTTTCTCATGCTAACGACGATGGCTGGGAAGAATTCGTTGCCGAGCTG
GAACAGCTGAATATCCGGCAGGCTTTCATCCGATCAATGTCATTACACACAATCGAGGATCTAACTTCCTGCATC
CTGGACTTTCAGGCTAACATGGTTCGTGTGACATATCGGAAGAAAACCACGTTAGTGGATCCGGAGCATGTACCC
GCGCATAACGATGCATTGTCGTATATTTGGAATAACAGCCAGCTAGAAGTAGATGAAGATGATTTGGGCGGCATC
GTCCAATGGCGAAAATTGGGGTTCGAAAGTGAGGACATAGTACAAGAATTCAGTGAGGTTGGAGTTCTAGGTCTC
GATTGTTTGAGAAATTTTGTTGAAACAGATCCGGATTTCTCGAAGCTTGTATTGGAACAGTCTAGTAGGCCAGAA
GACCGGCGATGCCCCCTGGGAAAAGCATCGAATGAAGTAGTAGAGCTACTCTCCGTATATTGGAATATTTTTGAA
CCCGGTTATTCTACGTCGACGACATTCCAACCTTTCTTTCTAGATTTCTACAGAGTGCATTTCCTCGCAACGCGG
TTCTTCCTTAGAATGTGGGGTGAAAGTGGTGCGGCCATCGGTGATTTTCAACGGGTCCTCGATCTAGTCCAAAGC
CAAGTCAAGGTTGCTCTCCGTAGCGAAAGCGTTCGGCCATGGCGTGAAGTGGAACAGGAATTCAATCAATCCGAT
TACCGCGCTGTGCGTGACCGTCAGATGAAGGAGCTAGAATTGGAGGACGATTTACTGAATAAGGTGCCTGTTCGG
AATCTCCGGGCCAAGCTGTACAAAGAATCATATGAATTCGTCCGACAACAACGAATTCAATGCCTACTCCAGGGT
GCCTGGTTCGTTATAGCACTACCCCAGAATGCACCCAGGGAAGTGGTACGACGACCGAAAAGGCCCTGGCGATTT
ATGCGATTGGACAGCGGGCTAAAGTACTTACATTACGTTGACAGTGCCGTCAAGTTCCCTGTTCGGAGCGGCCTT
GAAGACCTACCCGATCGTATTGATGTCTCCTTGATCAATGATATTGCTACTGGAACATGTGCTCCTCCACCGAAT
GTCCTTCGAGGCGACGACGATTTACCCCCCGCTGGCGTACTCTCCCCTTCACCGTTGTCATTCTCACTTTTGAAC
GCACATGAAGGTTCTCTAGTAGATTTGATCGCTCCTGATCAATCCCGTTGGGCTGATTGGACAGACGGACTGAAT
ATGCTACGTAAAGATGGTGGGCACGCGCCTTCGACTGAGACGTCAAGTTTTGTGCAGGCGCTCACAGAGATCGGG
TTGAAGATCAAATTGTTAGATCTGTCAGGTGAAATGGTCGAGATACCCACAAACCTTACAGCTGGCCCTCCACCT
ACTGATACCAATTTTTTCTTTTCGGAATCCCTGCTATAA
Transcript >AgabiH97|091750
ATGTCCGCTGGTGGTGCATCCTCTTCCTCCAGGGTTTCTGGCCTTCCAAGCAGCACGCCGAAAGCACCTCCGCTT
GTACCCACAAACCACGTCACTACGCTGGAGGGCGTTACTGTCCGCGCTCGGATAGATCCAACCTTGACTGTAGAT
GACGTGTTGAAGCAACTGTGCTCTAGCCTCAAAAAAGAACCTGCTTCTGATTTTGCGTTGAGGGATGAATCAGAC
GAGCTTGTGACCAATGATAATTTGAGGAAGAAGATCAAGGGAAGAGTGGGTCTGAAACTTGTCAAATCGCCGTCA
CGTCAGGCCGCCGATACAGTAGAGGAGCTTCAAACCAGAGAGGAGAATGACGGCAAGTTGAGGATGGCTTTATTC
GAGCTGCAAAAATTCATTCGGGAGGAGCAATTTGTTCAAGAATTCCTCAAATACGGCGGCTTGCACATGTTGGTG
AATCATATATCCATTGCTTCACGCAATTCACTTGCTTACGCGCTTACTTCGATGCAAAATCTAATGGACTTTGAC
TACGGCTGGGGGAGTCTGGATGACAACTTCATCCTACGCGTAGTTCAGATACTTTCTTCATCTCAGTCGCCTATC
AACGTCTGTCGACCCGCAACGGTTATTCTTAAAAAGCTTGTCGAGGCCGATCCTCTAAGTGCGCCGGGAACGCTA
GCAAGCACTAGTAAAGGTCCCCCTGCACTTCCTCCCGGTTCTGTGTACCGTTACGGTTTCCAGGTCGTGTTTAAT
CAGATGAAAAAAGAACGGGGACTCTTAGGGACAGTAGTAGATCGTCTCGGAAGTGCAGACACAGCGATGGCTCAG
TACAGCATGATGCTCATTAACTCCCTTCTTTCTCATGCTAACGACGATGGCTGGGAAGAATTCGTTGCCGAGCTG
GAACAGCTGAATATCCGGCAGGCTTTCATCCGATCAATGTCATTACACACAATCGAGGATCTAACTTCCTGCATC
CTGGACTTTCAGGCTAACATGGTTCGTGTGACATATCGGAAGAAAACCACGTTAGTGGATCCGGAGCATGTACCC
GCGCATAACGATGCATTGTCGTATATTTGGAATAACAGCCAGCTAGAAGTAGATGAAGATGATTTGGGCGGCATC
GTCCAATGGCGAAAATTGGGGTTCGAAAGTGAGGACATAGTACAAGAATTCAGTGAGGTTGGAGTTCTAGGTCTC
GATTGTTTGAGAAATTTTGTTGAAACAGATCCGGATTTCTCGAAGCTTGTATTGGAACAGTCTAGTAGGCCAGAA
GACCGGCGATGCCCCCTGGGAAAAGCATCGAATGAAGTAGTAGAGCTACTCTCCGTATATTGGAATATTTTTGAA
CCCGGTTATTCTACGTCGACGACATTCCAACCTTTCTTTCTAGATTTCTACAGAGTGCATTTCCTCGCAACGCGG
TTCTTCCTTAGAATGTGGGGTGAAAGTGGTGCGGCCATCGGTGATTTTCAACGGGTCCTCGATCTAGTCCAAAGC
CAAGTCAAGGTTGCTCTCCGTAGCGAAAGCGTTCGGCCATGGCGTGAAGTGGAACAGGAATTCAATCAATCCGAT
TACCGCGCTGTGCGTGACCGTCAGATGAAGGAGCTAGAATTGGAGGACGATTTACTGAATAAGGTGCCTGTTCGG
AATCTCCGGGCCAAGCTGTACAAAGAATCATATGAATTCGTCCGACAACAACGAATTCAATGCCTACTCCAGGGT
GCCTGGTTCGTTATAGCACTACCCCAGAATGCACCCAGGGAAGTGGTACGACGACCGAAAAGGCCCTGGCGATTT
ATGCGATTGGACAGCGGGCTAAAGTACTTACATTACGTTGACAGTGCCGTCAAGTTCCCTGTTCGGAGCGGCCTT
GAAGACCTACCCGATCGTATTGATGTCTCCTTGATCAATGATATTGCTACTGGAACATGTGCTCCTCCACCGAAT
GTCCTTCGAGGCGACGACGATTTACCCCCCGCTGGCGTACTCTCCCCTTCACCGTTGTCATTCTCACTTTTGAAC
GCACATGAAGGTTCTCTAGTAGATTTGATCGCTCCTGATCAATCCCGTTGGGCTGATTGGACAGACGGACTGAAT
ATGCTACGTAAAGATGGTGGGCACGCGCCTTCGACTGAGACGTCAAGTTTTGTGCAGGCGCTCACAGAGATCGGG
TTGAAGATCAAATTGTTAGATCTGTCAGGTGAAATGGTCGAGATACCCACAAACCTTACAGCTGGCCCTCCACCT
ACTGATACCAATTTTTTCTTTTCGGAATCCCTGCTATAA
Gene >AgabiH97|091750
ATGTCCGCTGGTGGTGCATCCTCTTCCTCCAGGGTTTCTGGCCTTCCAAGCAGCACGCCGAAAGCACCTCCGCTT
GTACCCACAAACCACGTCACTACGCTGGAGGGCGTTACTGTCCGCGCTCGGATAGATCCAACCTTGACTGTAGAT
GACGTGTTGAAGCAACTGTGCTCTAGCCTCAAAAAAGAACCTGCTTCTGATTTTGCGTTGAGGGATGAATCAGAC
GAGCTTGTGACCAATGATAATTTGAGGAAGAAGATCAAGGGAAGAGTGGGTCTGAAGTGAGCATTTCGTCTAAGG
ATGAAGTGGATGGCATAGTCACTAACATGCGTATAACAGACTTGTCAAATCGCCGTCACGTCAGGCCGCCGATAC
AGTAGAGGAGCTTCAAACCAGAGAGGAGAATGACGGCAAGTTGAGGATGGCTTTATTCGAGCTGCAAAAATTCAT
TCGGGTACCTACAAATGGTCATTTTTTCCGTCTGAATACAACTTAAACGCGTTATAGGAGGAGCAATTTGTTCAA
GAATTCCTCAAATACGGCGGCTTGCACATGTTGGTGAATCATATATCCATTGCTTCACGCAATTCACTTGCTGTG
AGTCCATCATCACGTATCTTGTGTTCACATCGTCATAGTTCATATAGTACGCGCTTACTTCGATGCAAAATCTAA
TGGACTTTGACTACGGCTGGGGGAGTCTGGATGACAACTTCATCCTACGCGTAGTTCAGATACTTTCTTCATCTC
AGTCGCCTATCAACGTCTGTCGACCCGCAACGGTTATTCTTAAAAAGCTTGTCGAGGCCGATCCTCTAAGTGCGC
CGGGAACGCTAGCAAGCACTAGTAAAGGTCCCCCTGCACTTCCTCCCGGTTCTGTGTACCGTTACGGTTTCCAGG
TCGTGTTTAATCAGATGAAAAAAGAACGGGGACTCTTAGGGACAGTAGTAGATCGTCTCGGAAGTGCAGACACAG
CGATGGCTCAGTACAGGTACTACCATCAGCATTTCCCCGAATTTTGTGACTGACTGGTGCTCCAGCATGATGCTC
ATTAACTCCCTTCTTTCTCATGCTAACGACGATGGCTGGGAAGAATTCGTTGCCGAGCTGGAACAGCTGAATATC
CGGCAGGCTTTCATCGTGAGTGAAAGTTTTACCGCTCACGAGTGAGTAACACTAGTTGCTAAATGCCTCATAGCG
ATCAATGTCATTACACACAATCGAGGATCTAACTTCCTGCATCCTGGACTTTCAGGCTAACATGGTTCGTGTGAC
ATATCGGAAGAAAACCACGTTAGTGGATCCGGAGCATGTACCCGCGCATAACGATGCATTGTCGTATATTTGGAA
TAACAGCCAGCTAGAAGTAGATGAAGATGATTTGGGCGGCATCGTCCAATGGCGAAAATTGGGGTTCGAAAGTGA
GGACATAGTACAAGAATTCAGTGAGGTTGGAGTTCTAGGTCTCGATTGTTTGGTATGCGATTCTTTCTCAATGGG
GAAGCAAAACGTCACATAATATGTAATGCCAGAGAAATTTTGTTGAAACAGATCCGGATTTCTCGAAGGTGAGGG
ATTATTGGAACGTATTTCCAACTAAAGCGCTGACCCTGCATTTTTAAGCTTGTATTGGAACAGTCTAGTAGGCCA
GAAGACCGGCGATGCCCCCTGGGAAAAGCATCGAATGAAGTAGTAGAGCTACTCTCCGTATATTGGAATATTTTT
GAACCCGGTTGTTAGTACCACCGGACGACGTCATGAGGGATCTCGCTGACTCTGCTTTTAGATTCTACGTCGACG
ACATTCCAACCTTTCTTTCTAGATTTCTACAGAGTGCATTTCCTCGCAACGCGGTTCTTCCTTAGAATGTGGGGT
GAAAGTGGTGCGGCCATCGGTGATTTTCAACGGGTCCTCGATCTAGTCCAAAGCCAGTGCGTACTTTGTGACCCT
AAATTTCTTCATTTTAGAAACGTATTGATCTCAATCAAACCAGAGTCAAGGTTGCTCTCCGTAGCGAAAGCGTTC
GGCCATGGCGTGAAGTGGAACAGGAATTCAATCAATCCGATTACCGCGCTGTGCGTGACCGTCAGATGAAGGAGC
TAGAATTGGAGGACGATTTACTGAATAAGGTGCCTGTTCGGTAAGTCAACATGGATTTGTCAGGTCAAAATTGAT
CTTTATGCTATGTAATAATGCCTTCTAAGGAATCTCCGGGCCAAGCTGTACAAAGAATCATATGAATTCGTCCGA
CAACAACGAATTCAATGCCTACTCCAGGGTGCCTGGTTCGTTATAGCACTACCCCAGAATGCACCCAGGGAAGTG
GTACGACGACCGAAAAGGCCCTGGCGATTTATGCGATTGGTATGTAGTCACATTGAATGAACGGCCGAATAATGT
CGCTGTGAACTCAACAATGCCCAACAGGACAGCGGGCTAAAGTACTTACATTACGTTGACAGTGCCGTCAAGTTC
CCTGTTCGGAGCGGCCTTGAAGACCTACCCGATCGTATTGATGTCTCCTTGATCAATGATATTGCTACTGGAACA
TGTGCTCCTCCACCGAATGTCCTTCGAGGCGACGACGATTTACCCCCCGCTGGCGTACTCTCCCCTTCACCGTTG
TCATTCTCACTTTTGAACGCACATGAAGGTTCTCTAGTAGATTTGATCGCTCCTGATCAATCCCGTTGGGCTGAT
TGGACAGACGGACTGAATATGCTACGTAAAGATGGTGGGCACGCGCCTTCGACTGAGACGTCAAGTTTTGTGCAG
GCGCTCACAGAGATCGGGTTGAAGATCAAATTGTTAGGTAAGATTTATGTTGGTCTCGATGGATGGAGTAAATAT
TTGATTAACATCTGTACAGATCTGTCAGGTGAAATGGTCGAGATACCCACAAACCTTACAGCTGGCCCTCCACCT
ACTGATACCAATTTTTTCTTTTCGGAATCCCTGCTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail