Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091580
Gene name
Locationscaffold_6:871812..873494
Strand+
Gene length (bp)1682
Transcript length (bp)1335
Coding sequence length (bp)1335
Protein length (aa) 445

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01522 Polysacc_deac_1 Polysaccharide deacetylase 1.7E-28 175 289

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 92 354 1.0E-38
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 88 352 1.0E-33
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 88 352 1.0E-33
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 119 352 9.0E-33
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 159 354 1.0E-26
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P50325|CDA_AMYRO Chitin deacetylase OS=Amylomyces rouxii PE=1 SV=1 92 354 1.0E-38
sp|P0CP76|CDA_CRYNJ Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain JEC21 / ATCC MYA-565) GN=MP 84 PE=2 SV=1 88 352 1.0E-33
sp|P0CP77|CDA_CRYNB Chitin deacetylase OS=Cryptococcus neoformans var. neoformans serotype D (strain B-3501A) GN=MP 84 PE=3 SV=1 88 352 1.0E-33
sp|P82476|CDA_CRYNH Chitin deacetylase OS=Cryptococcus neoformans var. grubii serotype A (strain H99 / ATCC 208821 / CBS 10515 / FGSC 9487) GN=CNAG_01239 PE=1 SV=3 119 352 9.0E-33
sp|Q06703|CDA2_YEAST Chitin deacetylase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA2 PE=1 SV=1 159 354 1.0E-26
sp|Q06702|CDA1_YEAST Chitin deacetylase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDA1 PE=1 SV=1 159 354 5.0E-25
sp|O34798|PDAC_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaC OS=Bacillus subtilis (strain 168) GN=pdaC PE=1 SV=1 172 353 2.0E-19
sp|P54865|XYND_CELFI Bifunctional xylanase/deacetylase OS=Cellulomonas fimi GN=xynD PE=1 SV=1 178 351 4.0E-16
sp|Q8DP63|PGDA_STRR6 Peptidoglycan-N-acetylglucosamine deacetylase OS=Streptococcus pneumoniae (strain ATCC BAA-255 / R6) GN=pgdA PE=1 SV=1 178 351 8.0E-15
sp|Q04729|YFUM2_GEOSE Uncharacterized 30.6 kDa protein in fumA 3'region OS=Geobacillus stearothermophilus PE=3 SV=1 172 396 4.0E-14
sp|Q59674|XY11A_CELJA Bifunctional xylanase/xylan deacetylase OS=Cellvibrio japonicus GN=xyn11A PE=1 SV=1 178 354 7.0E-14
sp|P83513|XY11A_PSEXY Bifunctional xylanase/deacetylase OS=Pseudobutyrivibrio xylanivorans GN=xyn11A PE=1 SV=2 179 278 5.0E-13
sp|D4AM78|CDA_ARTBC Chitin deacetylase ARB_04768 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_04768 PE=3 SV=1 166 385 5.0E-13
sp|D4B5F9|PGDA_ARTBC Probable peptidoglycan-N-acetylglucosamine deacetylase ARB_03699 OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_03699 PE=1 SV=2 168 388 1.0E-12
sp|P50354|NODB_RHIGA Chitooligosaccharide deacetylase OS=Rhizobium galegae GN=nodB PE=3 SV=1 165 308 2.0E-12
sp|P50352|NODB_BRAEL Chitooligosaccharide deacetylase OS=Bradyrhizobium elkanii GN=nodB PE=3 SV=1 179 344 1.0E-11
sp|P04675|NODB_BRASP Chitooligosaccharide deacetylase OS=Bradyrhizobium sp. (strain ANU 289) GN=nodB PE=3 SV=2 179 344 6.0E-11
sp|P50355|NODB_RHISN Chitooligosaccharide deacetylase OS=Rhizobium sp. (strain NGR234) GN=nodB PE=3 SV=2 179 308 1.0E-10
sp|Q52845|NODB_RHILO Chitooligosaccharide deacetylase OS=Rhizobium loti (strain MAFF303099) GN=nodB PE=3 SV=2 179 308 6.0E-10
sp|Q07740|NODB_AZOC5 Chitooligosaccharide deacetylase OS=Azorhizobium caulinodans (strain ATCC 43989 / DSM 5975 / JCM 20966 / NBRC 14845 / NCIMB 13405 / ORS 571) GN=nodB PE=3 SV=2 179 344 1.0E-09
sp|P04676|NODB_RHILT Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. trifolii GN=nodB PE=3 SV=1 179 308 1.0E-09
sp|P04339|NODB_RHILV Chitooligosaccharide deacetylase OS=Rhizobium leguminosarum bv. viciae GN=nodB PE=3 SV=1 179 344 1.0E-09
sp|P50850|YLXY_BACSU Uncharacterized protein YlxY OS=Bacillus subtilis (strain 168) GN=ylxY PE=3 SV=2 168 343 2.0E-09
sp|O07596|YHEN_BACSU Putative polysaccharide deacetylase YheN OS=Bacillus subtilis (strain 168) GN=yheN PE=3 SV=1 173 345 9.0E-09
sp|O34928|PDAA_BACSU Peptidoglycan-N-acetylmuramic acid deacetylase PdaA OS=Bacillus subtilis (strain 168) GN=pdaA PE=1 SV=1 179 295 3.0E-08
sp|P02963|NODB_RHIME Chitooligosaccharide deacetylase OS=Rhizobium meliloti (strain 1021) GN=nodB PE=3 SV=3 179 298 3.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0005975 carbohydrate metabolic process Yes
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds Yes
GO:0008152 metabolic process No
GO:0003674 molecular_function No
GO:0016787 hydrolase activity No
GO:0003824 catalytic activity No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 421 443 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091580
MKLPLLALVCATHLATTSASLGSKKHVQVLKRQATTAPPPPKPSTPTNVPTATASGIPPLSKITMGMPSAPTPVV
TATFSAGAEPPIKGAPPLPSPFVFMLNEWPAQDRVPETNTPEVQEWMKELEGFNIPNISPTTDGSCAGDIEAAAQ
AAQRGWWTCGGYTRSTDIVACPDKLTWGVSFDDGPGPYTQTLLDYLKSKNISSTFFLVGSRVIERPTVVIEEYMA
GHEISVHTWSHRPLTSLSNEQIVAELGWTRKAIRRMIGVSPTTMRPPFGDIDDRVRAISLAMGMVPLLWTRTPSG
GVFDTNDWKVAAGEVTGLQSFQTFENIFNNASALDNGFIVLQHDVHEITVDMAVGYTLDAALNHNPKFTLKAIGQ
CTNTPATDMYLETTTNTTFPYPNNTKVDVDGDGKAETAIGATTSNAALIQSSIFTVLFGALMAVFGSMI*
Coding >AgabiH97|091580
ATGAAGCTGCCTCTCCTCGCCCTCGTCTGCGCGACCCACCTCGCCACCACCTCCGCCTCCCTCGGCTCCAAGAAA
CACGTCCAGGTCCTGAAGCGACAGGCCACTACGGCTCCTCCCCCACCAAAGCCCTCCACTCCCACCAATGTCCCC
ACCGCCACTGCCTCTGGTATTCCTCCTCTCTCCAAAATCACCATGGGCATGCCCTCTGCTCCCACCCCAGTCGTC
ACTGCTACCTTCAGCGCCGGCGCTGAACCCCCAATCAAAGGCGCACCACCTCTCCCCAGTCCTTTCGTATTTATG
CTGAATGAGTGGCCTGCACAAGATCGTGTTCCGGAAACAAATACCCCGGAAGTCCAAGAGTGGATGAAAGAATTG
GAGGGCTTCAATATCCCAAACATCTCTCCTACCACCGATGGTTCCTGTGCCGGCGATATCGAAGCTGCCGCTCAA
GCCGCCCAGCGCGGATGGTGGACTTGCGGTGGATATACTCGCAGTACAGATATCGTCGCTTGCCCTGACAAACTC
ACATGGGGTGTCAGTTTCGATGACGGTCCGGGCCCTTACACCCAAACCCTGCTCGACTATCTCAAGTCCAAGAAC
ATTTCTTCCACCTTTTTCCTTGTCGGATCACGCGTCATCGAGCGTCCCACAGTCGTCATAGAGGAATACATGGCT
GGCCATGAGATCAGCGTCCATACTTGGTCTCACAGGCCACTCACGTCTTTGTCTAATGAGCAAATCGTCGCCGAG
CTAGGTTGGACCCGCAAAGCCATCCGACGGATGATAGGCGTCTCTCCTACGACCATGCGCCCTCCCTTTGGTGAT
ATTGATGACCGAGTACGTGCCATCTCTCTTGCCATGGGCATGGTCCCTCTGTTGTGGACTCGTACCCCAAGCGGT
GGCGTCTTTGATACAAATGACTGGAAGGTCGCTGCCGGCGAAGTCACCGGGCTTCAATCGTTCCAGACCTTTGAA
AACATTTTCAACAATGCCAGCGCCCTTGACAACGGGTTCATTGTATTACAACACGATGTTCACGAAATCACTGTT
GACATGGCTGTCGGCTATACTCTCGATGCTGCGCTCAACCACAACCCCAAGTTCACCCTTAAGGCTATTGGTCAG
TGTACCAACACTCCGGCCACCGACATGTACCTGGAGACGACGACAAACACCACATTCCCCTACCCCAACAACACC
AAGGTCGATGTTGACGGTGATGGCAAGGCTGAGACAGCCATCGGAGCTACCACGTCCAATGCCGCTCTGATCCAA
AGCTCCATCTTCACCGTCCTCTTTGGTGCCCTCATGGCAGTATTTGGTAGCATGATCTAA
Transcript >AgabiH97|091580
ATGAAGCTGCCTCTCCTCGCCCTCGTCTGCGCGACCCACCTCGCCACCACCTCCGCCTCCCTCGGCTCCAAGAAA
CACGTCCAGGTCCTGAAGCGACAGGCCACTACGGCTCCTCCCCCACCAAAGCCCTCCACTCCCACCAATGTCCCC
ACCGCCACTGCCTCTGGTATTCCTCCTCTCTCCAAAATCACCATGGGCATGCCCTCTGCTCCCACCCCAGTCGTC
ACTGCTACCTTCAGCGCCGGCGCTGAACCCCCAATCAAAGGCGCACCACCTCTCCCCAGTCCTTTCGTATTTATG
CTGAATGAGTGGCCTGCACAAGATCGTGTTCCGGAAACAAATACCCCGGAAGTCCAAGAGTGGATGAAAGAATTG
GAGGGCTTCAATATCCCAAACATCTCTCCTACCACCGATGGTTCCTGTGCCGGCGATATCGAAGCTGCCGCTCAA
GCCGCCCAGCGCGGATGGTGGACTTGCGGTGGATATACTCGCAGTACAGATATCGTCGCTTGCCCTGACAAACTC
ACATGGGGTGTCAGTTTCGATGACGGTCCGGGCCCTTACACCCAAACCCTGCTCGACTATCTCAAGTCCAAGAAC
ATTTCTTCCACCTTTTTCCTTGTCGGATCACGCGTCATCGAGCGTCCCACAGTCGTCATAGAGGAATACATGGCT
GGCCATGAGATCAGCGTCCATACTTGGTCTCACAGGCCACTCACGTCTTTGTCTAATGAGCAAATCGTCGCCGAG
CTAGGTTGGACCCGCAAAGCCATCCGACGGATGATAGGCGTCTCTCCTACGACCATGCGCCCTCCCTTTGGTGAT
ATTGATGACCGAGTACGTGCCATCTCTCTTGCCATGGGCATGGTCCCTCTGTTGTGGACTCGTACCCCAAGCGGT
GGCGTCTTTGATACAAATGACTGGAAGGTCGCTGCCGGCGAAGTCACCGGGCTTCAATCGTTCCAGACCTTTGAA
AACATTTTCAACAATGCCAGCGCCCTTGACAACGGGTTCATTGTATTACAACACGATGTTCACGAAATCACTGTT
GACATGGCTGTCGGCTATACTCTCGATGCTGCGCTCAACCACAACCCCAAGTTCACCCTTAAGGCTATTGGTCAG
TGTACCAACACTCCGGCCACCGACATGTACCTGGAGACGACGACAAACACCACATTCCCCTACCCCAACAACACC
AAGGTCGATGTTGACGGTGATGGCAAGGCTGAGACAGCCATCGGAGCTACCACGTCCAATGCCGCTCTGATCCAA
AGCTCCATCTTCACCGTCCTCTTTGGTGCCCTCATGGCAGTATTTGGTAGCATGATCTAA
Gene >AgabiH97|091580
ATGAAGCTGCCTCTCCTCGCCCTCGTCTGCGCGACCCACCTCGCCACCACCTCCGCCTCCCTCGGCTCCAAGAAA
CACGTCCAGGTCCTGAAGCGACAGGCCACTACGGCTCCTCCCCCACCAAAGCCCTCCACTCCCACCAATGTCCCC
ACCGCCACTGCCTCTGGTATTCCTCCTCTCTCCAAAATCACCATGGGCATGCCCTCTGCTCCCACCCCAGTCGTC
ACTGCTACCTTCAGCGCCGGCGCTGAACCCCCAATCAAAGGCGCACCACCTCTCCCCAGTCCTTGTAAGCCGTCC
TCTCATATCCCACGACACATATTCTAATAATCTCTAGTCGTATTTATGCTGAATGAGTGGCCTGCACAAGATCGT
GTTCCGGAAACAAGTGCGCTACATTTCCCTCAACAAAGGGGATCCTGACTCAGTCCGCTTCTAGATACCCCGGAA
GTCCAAGAGTGGATGAAAGAATTGGAGGGCTTCAATATCCCAAACATCTCTCCTACCACCGATGGTTCCTGTGCC
GGCGATATCGAAGCTGCCGCTCAAGCCGCCCAGCGCGGATGGTGGACTTGCGGTGGATATACTCGCAGTACAGGT
TTGTTCTCCATTTCATTTTTTTCCCACCATGTCGTAATTTTGCCTAGATATCGTCGCTTGCCCTGACAAACTCAC
ATGGGGTGTCAGTTTCGATGACGGTCCGGGCCCTTACAGTCAGTTCATCATGTTCCTAGCCGCATGGCAACAACT
CACGCCTTGTAGCCCAAACCCTGCTCGACTATCTCAAGTCCAAGAACATTTCTTCCACCTTTTTCCTTGTCGGAT
CACGCGTCATCGAGCGTCCCACAGTCGTCATAGAGGAATACATGGCTGGCCATGAGATCAGCGTCCATACTTGGT
CTCACAGGGTAAACCTTAGCTTCTCCTCACCATTTTTCACTCTGACCTCAACCTGAACAGCCACTCACGTCTTTG
TCTAATGAGCAAATCGTCGCCGAGCTAGGTTGGACCCGCAAAGCCATCCGACGGATGATAGGCGTCTCTCCTACG
ACCATGCGCCCTCCCTTTGGTGATATTGGTCTGTCCTTTCTTCATCTACAATATGCAAATCCTAATTATATTTAT
AGATGACCGAGTACGTGCCATCTCTCTTGCCATGGGCATGGTCCCTCTGTTGTGGACTCGTACCCCAAGCGGTGG
CGTCTTTGATACAAATGGTGCGCCCCAATGGCTATATGCCTGGACTTTTGCTGACACGTATCCTAGACTGGAAGG
TCGCTGCCGGCGAAGTCACCGGGCTTCAATCGTTCCAGACCTTTGAAAACATTTTCAACAATGCCAGCGCCCTTG
ACAACGGGTTCATTGTATTACAACACGATGTTCACGAAATCACTGTTGACATGGCTGTCGGCTATACTCTCGATG
CTGCGCTCAACCACAACCCCAAGTTCACCCTTAAGGCTATTGGTCAGTGTACCAACACTCCGGCCACCGACATGT
ACCTGGAGACGACGACAAACACCACATTCCCCTACCCCAACAACACCAAGGTCGATGTTGACGGTGATGGCAAGG
CTGAGACAGCCATCGGAGCTACCACGTCCAATGCCGCTCTGATCCAAAGCTCCATCTTCACCGTCCTCTTTGGTG
CCCTCATGGCAGTATTTGGTAGCATGATCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail