Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091570
Gene name
Locationscaffold_6:866704..871653
Strand-
Gene length (bp)4949
Transcript length (bp)4170
Coding sequence length (bp)4170
Protein length (aa) 1390

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 4.5E-69 984 1260
PF00621 RhoGEF RhoGEF domain 3.1E-35 580 761
PF15405 PH_5 Pleckstrin homology domain 4.8E-28 800 949
PF00610 DEP Domain found in Dishevelled, Egl-10, and Pleckstrin (DEP) 1.5E-13 381 450

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 262 1277 0.0E+00
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 361 1277 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 320 1260 1.0E-177
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 362 1260 1.0E-139
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 457 1258 2.0E-50
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 262 1277 0.0E+00
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 361 1277 0.0E+00
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 320 1260 1.0E-177
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 362 1260 1.0E-139
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 457 1258 2.0E-50
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 555 863 2.0E-27
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 556 863 1.0E-26
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 556 863 5.0E-24
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 556 863 6.0E-24
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 556 863 7.0E-24
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 556 863 2.0E-23
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 565 777 6.0E-23
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 534 780 7.0E-23
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 565 777 1.0E-22
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 480 780 2.0E-22
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 556 863 9.0E-22
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 480 780 4.0E-21
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 557 808 8.0E-21
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 557 806 2.0E-20
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 573 854 3.0E-20
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 557 780 5.0E-20
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 576 805 1.0E-19
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 557 780 1.0E-18
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 553 832 2.0E-18
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 557 805 3.0E-18
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 572 854 5.0E-18
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 557 805 1.0E-16
sp|Q8IW93|ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens GN=ARHGEF19 PE=1 SV=1 565 838 5.0E-16
sp|Q8BWA8|ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus GN=Arhgef19 PE=1 SV=1 565 838 4.0E-15
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 573 824 3.0E-14
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 575 836 8.0E-13
sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 514 825 9.0E-13
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 575 834 9.0E-13
sp|E9Q7D5|ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus GN=Arhgef5 PE=1 SV=1 505 825 1.0E-12
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 572 824 3.0E-12
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 573 853 4.0E-12
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 573 829 4.0E-12
sp|Q5FWH6|ARHGF_MOUSE Rho guanine nucleotide exchange factor 15 OS=Mus musculus GN=Arhgef15 PE=1 SV=1 565 782 8.0E-12
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 533 768 8.0E-12
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 576 825 9.0E-12
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 569 768 1.0E-11
sp|Q3KR16|PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens GN=PLEKHG6 PE=1 SV=3 557 858 2.0E-11
sp|O94989|ARHGF_HUMAN Rho guanine nucleotide exchange factor 15 OS=Homo sapiens GN=ARHGEF15 PE=1 SV=4 565 782 2.0E-11
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 567 840 2.0E-11
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 570 825 3.0E-11
sp|Q5R5M3|ARGAL_PONAB Rho guanine nucleotide exchange factor 10-like protein OS=Pongo abelii GN=ARHGEF10L PE=2 SV=1 551 776 3.0E-11
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 581 824 3.0E-11
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 575 834 4.0E-11
sp|Q5RDK0|ARHG9_PONAB Rho guanine nucleotide exchange factor 9 OS=Pongo abelii GN=ARHGEF9 PE=2 SV=1 576 825 5.0E-11
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 581 824 5.0E-11
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 572 824 7.0E-11
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 572 824 1.0E-10
sp|Q09763|GEF1_SCHPO Rho guanine nucleotide exchange factor gef1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=gef1 PE=1 SV=1 454 774 1.0E-10
sp|Q58DL7|ARHG9_BOVIN Rho guanine nucleotide exchange factor 9 OS=Bos taurus GN=ARHGEF9 PE=2 SV=1 569 825 2.0E-10
sp|A2AWP8|ARGAL_MOUSE Rho guanine nucleotide exchange factor 10-like protein OS=Mus musculus GN=Arhgef10l PE=1 SV=1 543 776 2.0E-10
sp|Q3UTH8|ARHG9_MOUSE Rho guanine nucleotide exchange factor 9 OS=Mus musculus GN=Arhgef9 PE=1 SV=1 576 825 3.0E-10
sp|O43307|ARHG9_HUMAN Rho guanine nucleotide exchange factor 9 OS=Homo sapiens GN=ARHGEF9 PE=1 SV=3 569 825 3.0E-10
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 549 827 3.0E-10
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 576 825 4.0E-10
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 567 776 5.0E-10
sp|Q9HCE6|ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens GN=ARHGEF10L PE=1 SV=3 551 776 5.0E-10
sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=1 SV=2 549 827 5.0E-10
sp|Q29RM4|ARGAL_BOVIN Rho guanine nucleotide exchange factor 10-like protein OS=Bos taurus GN=ARHGEF10L PE=2 SV=1 551 776 5.0E-10
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 573 853 5.0E-10
sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 549 827 5.0E-10
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 576 826 6.0E-10
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 576 824 1.0E-09
sp|Q553D3|GXCJJ_DICDI Rac guanine nucleotide exchange factor JJ OS=Dictyostelium discoideum GN=gxcJJ PE=1 SV=1 576 780 1.0E-09
sp|Q7TT49|MRCKB_RAT Serine/threonine-protein kinase MRCK beta OS=Rattus norvegicus GN=Cdc42bpb PE=1 SV=1 924 1263 1.0E-09
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 576 854 2.0E-09
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 573 853 2.0E-09
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 576 825 2.0E-09
sp|O14578|CTRO_HUMAN Citron Rho-interacting kinase OS=Homo sapiens GN=CIT PE=1 SV=2 887 1245 2.0E-09
sp|P11433|CDC24_YEAST Cell division control protein 24 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDC24 PE=1 SV=2 578 853 3.0E-09
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 549 827 3.0E-09
sp|Q8R0J1|PKHG6_MOUSE Pleckstrin homology domain-containing family G member 6 OS=Mus musculus GN=Plekhg6 PE=2 SV=2 567 858 3.0E-09
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 576 824 4.0E-09
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 576 854 4.0E-09
sp|P49025|CTRO_MOUSE Citron Rho-interacting kinase OS=Mus musculus GN=Cit PE=1 SV=3 887 1245 8.0E-09
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 582 824 1.0E-08
sp|Q23356|MIG15_CAEEL Serine/threonine-protein kinase mig-15 OS=Caenorhabditis elegans GN=mig-15 PE=2 SV=3 969 1252 1.0E-08
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 557 825 2.0E-08
sp|P28818|RGRF1_RAT Ras-specific guanine nucleotide-releasing factor 1 OS=Rattus norvegicus GN=Rasgrf1 PE=1 SV=1 557 825 2.0E-08
sp|Q8N1W1|ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens GN=ARHGEF28 PE=1 SV=3 557 783 2.0E-08
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 575 855 3.0E-08
sp|A1IGU4|ARH37_MOUSE Rho guanine nucleotide exchange factor 37 OS=Mus musculus GN=Arhgef37 PE=2 SV=1 580 778 4.0E-08
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 576 780 5.0E-08
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 558 762 1.0E-07
sp|A1IGU5|ARH37_HUMAN Rho guanine nucleotide exchange factor 37 OS=Homo sapiens GN=ARHGEF37 PE=2 SV=2 579 768 1.0E-07
sp|Q91VS8|FARP2_MOUSE FERM, RhoGEF and pleckstrin domain-containing protein 2 OS=Mus musculus GN=Farp2 PE=1 SV=2 581 854 2.0E-07
sp|Q54J11|GXCI_DICDI RhoGEF domain-containing protein gxcI OS=Dictyostelium discoideum GN=gxcI PE=3 SV=3 571 769 2.0E-07
sp|Q60875|ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus GN=Arhgef2 PE=1 SV=4 557 780 2.0E-07
sp|A1L390|PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens GN=PLEKHG3 PE=1 SV=1 579 849 2.0E-07
sp|A1IGU3|ARH37_RAT Rho guanine nucleotide exchange factor 37 OS=Rattus norvegicus GN=Arhgef37 PE=2 SV=1 580 777 3.0E-07
sp|Q21653|OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans GN=osg-1 PE=2 SV=4 576 780 4.0E-07
sp|P27671|RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus GN=Rasgrf1 PE=1 SV=2 557 825 4.0E-07
sp|Q008S8|ECT2L_HUMAN Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens GN=ECT2L PE=2 SV=2 571 864 4.0E-07
sp|Q5FVC2|ARHG2_RAT Rho guanine nucleotide exchange factor 2 OS=Rattus norvegicus GN=Arhgef2 PE=1 SV=1 557 780 4.0E-07
sp|Q9Y5S2|MRCKB_HUMAN Serine/threonine-protein kinase MRCK beta OS=Homo sapiens GN=CDC42BPB PE=1 SV=2 924 1258 5.0E-07
sp|Q6P9R4|ARHGI_MOUSE Rho guanine nucleotide exchange factor 18 OS=Mus musculus GN=Arhgef18 PE=1 SV=2 557 776 5.0E-07
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 573 809 7.0E-07
sp|B2DCZ9|ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa GN=ARHGEF2 PE=2 SV=1 557 813 9.0E-07
sp|Q6PAJ1|BCR_MOUSE Breakpoint cluster region protein OS=Mus musculus GN=Bcr PE=1 SV=3 620 790 1.0E-06
sp|Q6ZSZ5|ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens GN=ARHGEF18 PE=1 SV=3 557 783 1.0E-06
sp|Q9NHV9|VAV_DROME Protein vav OS=Drosophila melanogaster GN=Vav PE=1 SV=2 570 764 1.0E-06
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 579 825 1.0E-06
sp|P40995|SCD1_SCHPO Rho guanine nucleotide exchange factor scd1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=scd1 PE=1 SV=2 582 827 1.0E-06
sp|P97820|M4K4_MOUSE Mitogen-activated protein kinase kinase kinase kinase 4 OS=Mus musculus GN=Map4k4 PE=1 SV=1 973 1252 1.0E-06
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 557 824 2.0E-06
sp|Q11100|TAG52_CAEEL Putative protein tag-52 OS=Caenorhabditis elegans GN=tag-52 PE=3 SV=1 578 823 2.0E-06
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 620 790 3.0E-06
sp|O01583|MRCK_CAEEL Serine/threonine-protein kinase mrck-1 OS=Caenorhabditis elegans GN=mrck-1 PE=2 SV=3 924 1269 3.0E-06
sp|P97433|ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus GN=Arhgef28 PE=1 SV=1 557 783 3.0E-06
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 562 762 3.0E-06
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 564 849 4.0E-06
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 574 788 7.0E-06
sp|Q6KAU7|PKHG2_MOUSE Pleckstrin homology domain-containing family G member 2 OS=Mus musculus GN=Plekhg2 PE=2 SV=2 561 788 7.0E-06
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 495 1044 8.0E-06
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 562 762 8.0E-06
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 581 824 8.0E-06
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 581 824 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0035556 intracellular signal transduction Yes
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0007165 signal transduction No
GO:0050794 regulation of cellular process No
GO:0030695 GTPase regulator activity No
GO:0008150 biological_process No
GO:0030234 enzyme regulator activity No
GO:0065007 biological regulation No
GO:0009987 cellular process No
GO:0050789 regulation of biological process No
GO:0098772 molecular function regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 32 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091570
MTVGHFGEQWLPAVSRMDRPMGPRQPPDRRHAAAYDAIFKRPAATAPPFPQTPPLPGQVPYQQLHDRRTSAASFS
SGFSHNGIPPGSYRQSYYPPPPHIAHHLSPPTFDHQLPAPYNHPPPRARSILSTAHSSDGIVLHPDEPPDLDPHG
LTPAQAYQAQFFADGSPPAPQPDRNRYRSSPASPDRNSLPHPHHHDLPRLGVNIDTDDGRLGIDFTGSSGNSSDD
GSSELPWVTNERSSQRSHHHHPINNELLNALQVDTSAPQQSNRSSFASLSPASSAPDTSVTAVDHAFPGRRSSES
TRTMPKMLTTRRERSTQERSMSMSSATASSRTMIDQKRSSRPFPSLEGRNSPGTVAPRQRKTPIVYPAVLSRVAD
AFRERIPLGDRVKDGLTYKDAFDGREAVDKIAYIIKTTDRNLALLLGRALDAQKFFHDVTYDHRLRDSPNELYQF
KTKLGPYVSGEIVKPDSNGTAATTPSTTTPGADDLQDADDTPLPSGVFTLLTDCYSPTCSRDRLCYSIACPRRLE
QQARLNMKPQPGLSKQISKESLLDLPELGTIWAQSVPPEIVKSVSDSEAKRQETINEVIYTERDFVRDMEYLRDT
WMQRLQESEVIPPERRSTFIQQVFWNVRDIIAVNTKLRDALTKRQKSYAVVDRIGDIFLDIAPQFAQPFVAYGAH
QLYGKYEFEREKDQNPAFAQFVETTERLPESRKLELNAFLTKPTTRLARYPLLLESVLKNTPEDSSDKTMIPKAV
VMIRELLNKLNQETGKTENRFNLAQLENQLYFKPGEEVDLKLKEPGREMITKGTLVKRDGEILVHLFDHAILFTK
SVKNKQLEHLRVYRRPIPLELLCISFSDDLPNSNGTVRTRRQPGLVRKSSFGREHHRSSGGGGGGGGGGGSSAGG
HGPIIVPSEAKGQYWISFHHLGRKAYNLVLWATSVSSQKKWVEGIQKQQGKMRERSCIFECVTLSESFFAGPNKV
NCAAPFSQGRKVVYGTDDGVYISDLRESGRDPIKVLSLLEVSQVDVLEDYQLMIVLSERQVITFPLDALDQIDPM
AGLKRAKRISSHTSFFKAGFCLGRVLVCIVKSSQLSSTFKALEPIDQNVRGRSKPTFKKLLQGGNDTLKPFREFY
IPVESTSIHYLKTKMCVGCSRGFEIVDLETLETQGLLDPEDASLDFVKRRENLRPMALYRIQNEFLLCYDEFAFY
VNKSGQRTRTEFMVHWEGQPTGFALHEPYILAFEPNFIEIRHIETGYLAQVIQGSNLRLLFADSPPTSGPKGSLL
HSQHSPGMMMSSPHGGFGGYPPPPPPSQGQGYLGQPGGGGFGRQGGGLNEGRDEILVCSDDRVFVLRPAVARPTT
GASIPPQLQPQTQPPLSVGQGHQSSMSMPADFSWTSLTR*
Coding >AgabiH97|091570
ATGACGGTGGGTCACTTTGGTGAGCAGTGGTTGCCCGCCGTCTCGAGGATGGATCGCCCGATGGGCCCGCGACAG
CCGCCTGACCGCCGCCACGCTGCTGCTTACGACGCCATCTTCAAGCGGCCCGCAGCGACCGCCCCGCCCTTTCCG
CAGACTCCGCCCCTGCCCGGGCAGGTCCCGTATCAGCAATTGCACGACCGACGCACCTCTGCTGCCTCCTTCTCC
TCTGGCTTTTCTCACAACGGCATCCCCCCCGGCTCTTACCGCCAGTCCTACTACCCCCCGCCACCCCACATCGCA
CACCACCTCTCCCCTCCCACCTTTGACCACCAGCTTCCCGCCCCGTACAACCACCCCCCGCCCAGGGCCCGATCC
ATTCTCAGCACTGCACATTCCTCCGACGGCATCGTTCTCCACCCCGATGAACCCCCAGACCTCGACCCCCACGGT
CTCACCCCCGCACAGGCGTACCAGGCACAGTTCTTCGCGGATGGCTCTCCTCCCGCCCCCCAACCCGACCGCAAT
CGCTACCGCTCGTCTCCTGCCTCTCCGGACCGCAATTCGTTACCCCACCCCCACCATCACGATCTCCCCAGATTG
GGTGTTAATATAGACACCGATGATGGTCGCCTTGGCATAGATTTCACCGGCAGTAGTGGCAATTCCAGTGACGAT
GGCAGCAGCGAGCTCCCTTGGGTAACCAACGAACGATCAAGTCAAAGGTCTCACCATCATCACCCCATCAACAAT
GAACTACTTAATGCACTTCAGGTCGACACCTCGGCACCCCAACAGTCAAACCGCTCTTCGTTCGCCAGCCTATCC
CCCGCTTCCTCGGCTCCAGACACTTCTGTCACCGCAGTAGACCATGCTTTCCCCGGCCGTCGATCTTCAGAGTCT
ACCAGGACAATGCCCAAAATGCTCACCACTCGTCGTGAACGATCCACTCAGGAACGCTCCATGTCCATGTCCTCC
GCCACCGCCTCTTCAAGAACCATGATTGACCAAAAACGAAGTTCACGCCCCTTTCCTTCCTTGGAGGGTCGCAAT
TCTCCTGGCACGGTTGCCCCTAGGCAGAGAAAAACACCCATCGTCTATCCAGCCGTCCTCTCTCGCGTAGCAGAC
GCCTTCCGTGAACGAATACCCCTCGGTGACCGCGTCAAAGATGGCCTCACCTACAAAGATGCTTTCGATGGCCGA
GAGGCGGTGGATAAAATCGCCTATATCATCAAGACAACCGATCGAAATTTGGCTTTGTTGCTGGGACGTGCGCTG
GATGCACAAAAATTTTTCCATGATGTCACATATGACCATCGACTAAGAGACAGTCCGAATGAGCTATACCAATTC
AAGACTAAACTGGGACCTTATGTGAGTGGAGAGATTGTCAAGCCAGATTCGAATGGGACTGCCGCTACAACCCCG
TCTACCACCACACCGGGAGCAGATGACCTTCAGGACGCAGATGACACTCCCCTTCCTTCAGGTGTCTTTACACTC
CTTACAGATTGTTATTCACCTACTTGTTCGAGAGATCGCCTATGTTATAGTATCGCTTGTCCTCGAAGGCTAGAG
CAACAAGCGAGGCTGAACATGAAACCACAACCAGGGTTGTCCAAACAAATCAGCAAAGAAAGTTTATTGGATCTG
CCTGAACTCGGTACCATATGGGCTCAATCTGTTCCCCCAGAAATCGTCAAGAGCGTTTCGGATTCGGAGGCGAAG
AGGCAAGAGACTATCAATGAAGTCATATACACCGAACGCGACTTTGTACGGGATATGGAATACCTCCGTGATACT
TGGATGCAACGATTACAAGAATCAGAAGTCATCCCACCTGAACGACGAAGCACATTTATTCAACAAGTCTTTTGG
AACGTCCGGGATATTATCGCTGTCAATACCAAACTACGCGATGCTTTGACTAAGCGACAGAAATCGTATGCGGTT
GTAGATCGGATAGGTGATATATTTTTGGATATTGCACCTCAATTTGCGCAACCGTTTGTGGCGTATGGTGCTCAT
CAGCTTTATGGGAAATATGAATTTGAGAGGGAGAAGGATCAGAATCCTGCTTTTGCGCAATTTGTTGAAACTACA
GAACGATTACCTGAATCACGGAAATTGGAATTGAATGCTTTTTTGACGAAACCGACGACACGGCTTGCTCGATAC
CCATTGTTATTGGAGAGTGTGTTGAAAAATACACCGGAGGATAGTTCGGATAAGACGATGATACCCAAGGCTGTT
GTTATGATCAGGGAACTATTGAATAAATTGAATCAAGAGACGGGGAAGACGGAGAATAGGTTTAATTTGGCGCAG
TTGGAGAATCAGTTGTACTTTAAACCTGGTGAGGAAGTGGATTTGAAATTGAAGGAGCCGGGGAGGGAGATGATT
ACGAAGGGGACGTTGGTGAAAAGGGATGGAGAGATTTTGGTGCATTTGTTTGATCATGCGATTTTGTTTACGAAG
AGTGTGAAGAATAAGCAGTTGGAACATCTTAGAGTTTATAGAAGGCCAATACCCCTCGAATTGCTGTGTATCTCA
TTTTCAGATGATCTACCCAACTCGAATGGAACGGTTCGTACACGTCGTCAACCAGGTCTAGTCAGAAAATCTTCA
TTCGGACGTGAACATCATCGAAGTAGCGGTGGTGGTGGTGGTGGAGGCGGTGGTGGGGGTAGTAGTGCTGGAGGA
CATGGACCGATTATAGTGCCGAGTGAAGCGAAAGGGCAATATTGGATTAGTTTTCATCATTTGGGGAGGAAGGCG
TATAATTTGGTGTTGTGGGCGACGAGTGTCTCGAGTCAGAAGAAATGGGTGGAGGGGATACAGAAACAGCAAGGG
AAGATGAGGGAGAGGAGTTGTATTTTTGAGTGTGTGACGTTGAGTGAGAGTTTTTTTGCGGGTCCGAATAAGGTG
AATTGTGCGGCTCCGTTTAGTCAGGGGAGGAAAGTGGTTTATGGGACGGATGATGGGGTTTATATATCGGATTTG
AGAGAGTCGGGGAGAGATCCGATTAAGGTTCTTTCGTTGTTGGAGGTATCGCAGGTGGACGTATTAGAAGATTAT
CAATTGATGATCGTCCTATCCGAACGACAAGTGATAACGTTTCCTTTGGATGCTTTGGATCAGATTGATCCTATG
GCGGGATTAAAACGTGCGAAACGGATATCGTCGCATACGTCTTTTTTCAAGGCTGGGTTTTGTTTGGGGAGGGTG
TTGGTGTGTATTGTCAAGTCGAGTCAGTTGTCGAGTACGTTTAAGGCGTTGGAGCCGATTGATCAGAATGTGAGG
GGGAGGAGTAAACCGACGTTTAAGAAGTTGTTGCAGGGAGGGAATGATACACTTAAACCTTTCAGAGAATTTTAT
ATACCGGTGGAATCGACGTCGATACATTATTTGAAGACGAAGATGTGTGTGGGGTGTTCGAGAGGGTTTGAGATT
GTGGATTTGGAGACGTTGGAGACGCAGGGGTTGTTGGATCCGGAGGATGCGAGTTTGGATTTTGTGAAGAGGAGA
GAGAATTTGAGACCTATGGCGTTGTATAGGATTCAGAATGAGTTTTTGTTGTGTTATGATGAGTTTGCGTTTTAT
GTGAATAAGAGTGGGCAGAGGACACGTACGGAGTTTATGGTTCATTGGGAAGGACAACCCACAGGATTTGCGTTA
CACGAGCCTTATATCCTCGCTTTCGAACCCAATTTTATCGAGATCCGACATATAGAGACGGGATATCTAGCTCAA
GTGATTCAAGGCTCAAATCTACGATTACTGTTTGCGGATTCGCCACCGACGAGTGGTCCGAAAGGGTCATTGTTG
CATTCGCAACATTCACCAGGGATGATGATGTCATCGCCACATGGTGGTTTTGGAGGGTATCCTCCTCCTCCTCCT
CCTTCACAAGGACAAGGGTATTTGGGACAACCAGGAGGGGGAGGATTTGGGAGACAAGGTGGGGGGTTGAATGAA
GGGAGAGATGAGATATTGGTGTGTTCGGATGATCGGGTGTTTGTGCTTAGACCTGCTGTTGCTCGGCCTACGACA
GGTGCTTCTATACCACCACAATTACAACCCCAAACGCAGCCACCGTTGTCTGTTGGACAGGGTCATCAGAGTTCG
ATGTCGATGCCGGCGGATTTTTCGTGGACGTCGTTGACTCGATGA
Transcript >AgabiH97|091570
ATGACGGTGGGTCACTTTGGTGAGCAGTGGTTGCCCGCCGTCTCGAGGATGGATCGCCCGATGGGCCCGCGACAG
CCGCCTGACCGCCGCCACGCTGCTGCTTACGACGCCATCTTCAAGCGGCCCGCAGCGACCGCCCCGCCCTTTCCG
CAGACTCCGCCCCTGCCCGGGCAGGTCCCGTATCAGCAATTGCACGACCGACGCACCTCTGCTGCCTCCTTCTCC
TCTGGCTTTTCTCACAACGGCATCCCCCCCGGCTCTTACCGCCAGTCCTACTACCCCCCGCCACCCCACATCGCA
CACCACCTCTCCCCTCCCACCTTTGACCACCAGCTTCCCGCCCCGTACAACCACCCCCCGCCCAGGGCCCGATCC
ATTCTCAGCACTGCACATTCCTCCGACGGCATCGTTCTCCACCCCGATGAACCCCCAGACCTCGACCCCCACGGT
CTCACCCCCGCACAGGCGTACCAGGCACAGTTCTTCGCGGATGGCTCTCCTCCCGCCCCCCAACCCGACCGCAAT
CGCTACCGCTCGTCTCCTGCCTCTCCGGACCGCAATTCGTTACCCCACCCCCACCATCACGATCTCCCCAGATTG
GGTGTTAATATAGACACCGATGATGGTCGCCTTGGCATAGATTTCACCGGCAGTAGTGGCAATTCCAGTGACGAT
GGCAGCAGCGAGCTCCCTTGGGTAACCAACGAACGATCAAGTCAAAGGTCTCACCATCATCACCCCATCAACAAT
GAACTACTTAATGCACTTCAGGTCGACACCTCGGCACCCCAACAGTCAAACCGCTCTTCGTTCGCCAGCCTATCC
CCCGCTTCCTCGGCTCCAGACACTTCTGTCACCGCAGTAGACCATGCTTTCCCCGGCCGTCGATCTTCAGAGTCT
ACCAGGACAATGCCCAAAATGCTCACCACTCGTCGTGAACGATCCACTCAGGAACGCTCCATGTCCATGTCCTCC
GCCACCGCCTCTTCAAGAACCATGATTGACCAAAAACGAAGTTCACGCCCCTTTCCTTCCTTGGAGGGTCGCAAT
TCTCCTGGCACGGTTGCCCCTAGGCAGAGAAAAACACCCATCGTCTATCCAGCCGTCCTCTCTCGCGTAGCAGAC
GCCTTCCGTGAACGAATACCCCTCGGTGACCGCGTCAAAGATGGCCTCACCTACAAAGATGCTTTCGATGGCCGA
GAGGCGGTGGATAAAATCGCCTATATCATCAAGACAACCGATCGAAATTTGGCTTTGTTGCTGGGACGTGCGCTG
GATGCACAAAAATTTTTCCATGATGTCACATATGACCATCGACTAAGAGACAGTCCGAATGAGCTATACCAATTC
AAGACTAAACTGGGACCTTATGTGAGTGGAGAGATTGTCAAGCCAGATTCGAATGGGACTGCCGCTACAACCCCG
TCTACCACCACACCGGGAGCAGATGACCTTCAGGACGCAGATGACACTCCCCTTCCTTCAGGTGTCTTTACACTC
CTTACAGATTGTTATTCACCTACTTGTTCGAGAGATCGCCTATGTTATAGTATCGCTTGTCCTCGAAGGCTAGAG
CAACAAGCGAGGCTGAACATGAAACCACAACCAGGGTTGTCCAAACAAATCAGCAAAGAAAGTTTATTGGATCTG
CCTGAACTCGGTACCATATGGGCTCAATCTGTTCCCCCAGAAATCGTCAAGAGCGTTTCGGATTCGGAGGCGAAG
AGGCAAGAGACTATCAATGAAGTCATATACACCGAACGCGACTTTGTACGGGATATGGAATACCTCCGTGATACT
TGGATGCAACGATTACAAGAATCAGAAGTCATCCCACCTGAACGACGAAGCACATTTATTCAACAAGTCTTTTGG
AACGTCCGGGATATTATCGCTGTCAATACCAAACTACGCGATGCTTTGACTAAGCGACAGAAATCGTATGCGGTT
GTAGATCGGATAGGTGATATATTTTTGGATATTGCACCTCAATTTGCGCAACCGTTTGTGGCGTATGGTGCTCAT
CAGCTTTATGGGAAATATGAATTTGAGAGGGAGAAGGATCAGAATCCTGCTTTTGCGCAATTTGTTGAAACTACA
GAACGATTACCTGAATCACGGAAATTGGAATTGAATGCTTTTTTGACGAAACCGACGACACGGCTTGCTCGATAC
CCATTGTTATTGGAGAGTGTGTTGAAAAATACACCGGAGGATAGTTCGGATAAGACGATGATACCCAAGGCTGTT
GTTATGATCAGGGAACTATTGAATAAATTGAATCAAGAGACGGGGAAGACGGAGAATAGGTTTAATTTGGCGCAG
TTGGAGAATCAGTTGTACTTTAAACCTGGTGAGGAAGTGGATTTGAAATTGAAGGAGCCGGGGAGGGAGATGATT
ACGAAGGGGACGTTGGTGAAAAGGGATGGAGAGATTTTGGTGCATTTGTTTGATCATGCGATTTTGTTTACGAAG
AGTGTGAAGAATAAGCAGTTGGAACATCTTAGAGTTTATAGAAGGCCAATACCCCTCGAATTGCTGTGTATCTCA
TTTTCAGATGATCTACCCAACTCGAATGGAACGGTTCGTACACGTCGTCAACCAGGTCTAGTCAGAAAATCTTCA
TTCGGACGTGAACATCATCGAAGTAGCGGTGGTGGTGGTGGTGGAGGCGGTGGTGGGGGTAGTAGTGCTGGAGGA
CATGGACCGATTATAGTGCCGAGTGAAGCGAAAGGGCAATATTGGATTAGTTTTCATCATTTGGGGAGGAAGGCG
TATAATTTGGTGTTGTGGGCGACGAGTGTCTCGAGTCAGAAGAAATGGGTGGAGGGGATACAGAAACAGCAAGGG
AAGATGAGGGAGAGGAGTTGTATTTTTGAGTGTGTGACGTTGAGTGAGAGTTTTTTTGCGGGTCCGAATAAGGTG
AATTGTGCGGCTCCGTTTAGTCAGGGGAGGAAAGTGGTTTATGGGACGGATGATGGGGTTTATATATCGGATTTG
AGAGAGTCGGGGAGAGATCCGATTAAGGTTCTTTCGTTGTTGGAGGTATCGCAGGTGGACGTATTAGAAGATTAT
CAATTGATGATCGTCCTATCCGAACGACAAGTGATAACGTTTCCTTTGGATGCTTTGGATCAGATTGATCCTATG
GCGGGATTAAAACGTGCGAAACGGATATCGTCGCATACGTCTTTTTTCAAGGCTGGGTTTTGTTTGGGGAGGGTG
TTGGTGTGTATTGTCAAGTCGAGTCAGTTGTCGAGTACGTTTAAGGCGTTGGAGCCGATTGATCAGAATGTGAGG
GGGAGGAGTAAACCGACGTTTAAGAAGTTGTTGCAGGGAGGGAATGATACACTTAAACCTTTCAGAGAATTTTAT
ATACCGGTGGAATCGACGTCGATACATTATTTGAAGACGAAGATGTGTGTGGGGTGTTCGAGAGGGTTTGAGATT
GTGGATTTGGAGACGTTGGAGACGCAGGGGTTGTTGGATCCGGAGGATGCGAGTTTGGATTTTGTGAAGAGGAGA
GAGAATTTGAGACCTATGGCGTTGTATAGGATTCAGAATGAGTTTTTGTTGTGTTATGATGAGTTTGCGTTTTAT
GTGAATAAGAGTGGGCAGAGGACACGTACGGAGTTTATGGTTCATTGGGAAGGACAACCCACAGGATTTGCGTTA
CACGAGCCTTATATCCTCGCTTTCGAACCCAATTTTATCGAGATCCGACATATAGAGACGGGATATCTAGCTCAA
GTGATTCAAGGCTCAAATCTACGATTACTGTTTGCGGATTCGCCACCGACGAGTGGTCCGAAAGGGTCATTGTTG
CATTCGCAACATTCACCAGGGATGATGATGTCATCGCCACATGGTGGTTTTGGAGGGTATCCTCCTCCTCCTCCT
CCTTCACAAGGACAAGGGTATTTGGGACAACCAGGAGGGGGAGGATTTGGGAGACAAGGTGGGGGGTTGAATGAA
GGGAGAGATGAGATATTGGTGTGTTCGGATGATCGGGTGTTTGTGCTTAGACCTGCTGTTGCTCGGCCTACGACA
GGTGCTTCTATACCACCACAATTACAACCCCAAACGCAGCCACCGTTGTCTGTTGGACAGGGTCATCAGAGTTCG
ATGTCGATGCCGGCGGATTTTTCGTGGACGTCGTTGACTCGATGA
Gene >AgabiH97|091570
ATGACGGTGGGTCACTTTGGTGAGCAGTGGTTGCCCGCCGTCTCGAGGATGGATCGCCCGATGGGCCCGCGACAG
CCGCCTGACCGCCGCCACGCTGCTGCTTACGACGCCATCTTCAAGCGGCCCGCAGCGACCGCCCCGCCCTTTCCG
CAGACTCCGCCCCTGCCCGGGCAGGTCCCGTATCAGCAATTGCACGACCGACGCACCTCTGCTGCCTCCTTCTCC
TCTGGCTTTTCTCACAACGGCATCCCCCCCGGCTCTTACCGCCAGTCCTACTACCCCCCGCCACCCCACATCGCA
CACCACCTCTCCCCTCCCACCTTTGACCACCAGCTTCCCGCCCCGTACAACCACCCCCCGCCCAGGGCCCGATCC
ATTCTCAGCACTGCACATTCCTCCGACGGCATCGTTCTCCACCCCGATGAACCCCCAGACCTCGACCCCCACGGT
CTCACCCCCGCACAGGCGTACCAGGCACAGTTCTTCGCGGATGGCTCTCCTCCCGCCCCCCAACCCGACCGCAAT
CGCTACCGCTCGTCTCCTGCCTCTCCGGACCGCAATTCGTTACCCCACCCCCACCATCACGATCTCCCCAGATTG
GGTGTTAATATAGACACCGATGATGGTCGCCTTGGCATAGATTTCACCGGCAGTAGTGGCAATTCCAGTGACGAT
GGCAGCAGCGAGCTCCCTTGGGTAACCAACGAACGATCAAGTCTGCACCCCTATTTTCTTCCTCCCCCCGTCCCA
TGTTGATTCGTTTCTAGGTCAAAGGTCTCACCATCATCACCCCATCAACAATGAACTACTTGTCTGTTTTTAATT
CCCCTGTCCTTCGTTTCCTGATTCGCTATCCATCCAACAGAATGCACTTCAGGTCGACACCTCGGCACCCCAACA
GTCAAACCGCTCTTCGTTCGCCAGCCTATCCCCCGCTTCCTCGGCTCCAGACACTTCTGTCACCGCAGTAGACCA
TGCTTTCCCCGGCCGTCGATCTTCAGAGTCTACCAGGACAATGCCCAAAATGCTCACCACTCGTCGTGAACGATC
CACTCAGGAACGCTCCATGTCCATGTCCTCCGCCACCGCCTCTTCAAGAACCATGATTGACCAAAAACGAAGTTC
ACGCCCCTTTCCTTCCTTGGAGGGTCGCAATTCTCCTGGCACGGTTGCCCCTAGGCAGAGAAAAACACCCATCGT
CTATCCAGCCGTCCTCTCTCGCGTAGCAGACGCCTTCCGTGAACGAATACCCCTCGGTGACCGCGTCAAAGATGG
CCTCACCTACAAAGATGCTTTCGATGGCCGAGAGGCGGTGGATAAAATCGCCTATATCATCAAGACAACCGATCG
AAATTTGGCTTTGTTGCTGGGACGTGCGCTGGATGCACAAAAATTTTTCCATGATGTCACATATGACCATCGACT
AAGAGACAGTCCGAATGAGCTATACCAATTCAAGACTAAACTGGGACCTTATGTGAGTGGAGAGATTGTCAAGCC
AGATTCGAATGGGGTACGTCTCTGTATGTCTTCCGACGAACCATGCTAACGACTTGAGAAAAAGACTGCCGCTAC
AACCCCGTCTACCACCACACCGGGAGCAGATGACCTTCAGGACGCAGATGACACTCCCCTTCCTTCAGGTGTCTT
TACACTCCTTACAGATTGTTATTCACCTACTTGTTCGAGAGATCGCCTATGTTATAGTATCGCTTGTCCTCGAAG
GCTAGAGCAACAAGCGAGGCTGAACATGAAACCACAACCAGGGTTGTCCAAACAAATCAGCAAAGAAAGTTTATT
GGATCTGCCTGTACGATTTACTTTTTTACTATAGGGAGATTTACCCCTAACTTTTTCTCAGGAACTCGGTACCAT
ATGGGCTCAATCTGTTCCCCCAGAAATCGTCAAGAGCGTTTCGGATTCGGAGGCGAAGAGGCAAGAGACTATCAA
TGAAGTCATATACACCGAACGCGACTTTGTACGGGATATGGAATACCTCCGTGATGTCAGCTGTCTGCGCCATTC
ATCTGATGGGGGTCGTACTCAATTCGTTTTTTCTATAGACTTGGATGCAACGATTACAAGAATCAGAAGTCATCC
CACCTGAACGACGAAGCACATTTATTCAACAAGTCTTTTGGAACGTCCGGGATATTATCGCTGTCAATACCAAAC
TACGCGATGCTTTGACTAAGCGACAGAAATCGTATGCGGTTGTAGATCGGATAGGTGATATATTTTTGGATATTG
CACCTCAATTTGCGCAACCGTTTGTGGCGTATGGTGCTCATCAGCTTTATGGGAAATATGAATTTGAGAGGGAGA
AGGATCAGAATCCTGCTTTTGCGCAATTTGTTGAAGTGGGTATTTATTTCAGTCATTCAATGAGTCACACCTTAT
GCTTTTTTTTTTTTTTTCTAGACTACAGAACGATTACCTGAATCACGGAAATTGGAATTGAATGCTTTTTTGACG
AAACCGACGACACGGCTTGCTCGATACCCATTGTTATTGGAGAGTGTGTTGAAAAATACACCGGAGGATAGTTCG
GATAAGACGATGATACCCAAGGCTGTTGTTATGATCAGGGAACTATTGAATAAATTGAATCAAGAGACGGGGAAG
ACGGAGAATAGGTTTAATTTGGCGCAGTTGGAGAATCAGTTGTACTTTAAACCTGGTGAGGAAGTGGTATGTACC
TCTCCTCCTTTATTCCTTCAACAAAAGAAGCGTTTTTTTTGATAATGTTTTTTTTTTTTTTTTGATAGGATTTGA
AATTGAAGGAGCCGGGGAGGGAGATGATTACGAAGGGGACGTTGGTGAAAAGGGATGGAGAGATTTTGGTGCATT
TGTTTGATCATGCGATTTTGTTTACGAAGAGTGTGAAGAATAAGCAGTTGGAACATCTTAGAGTTTATAGAAGGG
TAATGTCCAAATTCTCTTCCTTCAGACTCATAAAACTTAACTTTGGACTCACAGCCAATACCCCTCGAATTGCTG
TGTATCTCATTTTCAGATGATCTACCCAACTCGAATGGAACGGTTCGTACACGTCGTCAACCAGGTCTAGTCAGA
AAATCTTCATTCGGACGTGAACATCATCGAAGTAGCGGTGGTGGTGGTGGTGGAGGCGGTGGTGGGGGTAGTAGT
GCTGGAGGACATGGACCGATTATAGTGCCGAGTGAAGCGAAAGGGCAATATTGGATTAGTTTTCATCATTTGGGG
AGGAAGGCGTATAATTTGGTGTTGTGGGCGACGAGTGTCTCGAGTCAGAAGAAATGGGTGGAGGGGATACAGAAA
CAGCAAGGGAAGATGAGGGAGAGGAGTTGTATTTTTGAGTGTGTGACGTTGAGTGAGAGTTTTTTTGCGGGTCCG
AATAAGGTGAATTGTGCGGCTCCGTTTAGTGAGTTTTTTTTTTTTGGTTTTTTTGGATTTGTGGATGGGGGACTG
ATGTAGGTGGATGGGGTTTAGGTCAGGGGAGGAAAGTGGTTTATGGGACGGATGATGGGGTTTATATATCGGATT
TGAGAGAGTCGGGGAGAGATCCGATTAAGGTTCTTTCGTTGTTGGAGGTATCGCAGGTGGACGTATTAGAAGATT
ATCAATTGATGATCGTCCTATCCGGTAAGCATTTTTCTCTATCACTCTCCACTCTCAAAAAAAATTGTTCCTCAT
TTTTTTTTTTTGCAAATAGAACGACAAGTGATAACGTTTCCTTTGGATGCTTTGGATCAGATTGATCCTATGGCG
GGATTAAAACGTGCGAAACGGATATCGTCGCATACGTCTTTTTTCAAGGCTGGGTTTTGTTTGGGGAGGGTGTTG
GTGTGTATTGTCAAGTCGAGTCAGTTGTCGAGTACGTTTAAGGCGTTGGAGCCGATTGATCAGAATGTGAGGGGG
AGGAGTAAACCGACGTTTAAGAAGTTGTTGCAGGGAGGGAATGATACACTTAAACCTTTCAGAGTATGTTTTTTT
TTCGTTTCGTTTCGTGAATGGTATGTGCTGATTGATTGGGATAGGAATTTTATATACCGGTGGAATCGACGTCGA
TACATTATTTGAAGACGAAGATGTGTGTGGGGTGTTCGAGAGGGTTTGAGATTGTGGATTTGGAGACGTTGGAGA
CGCAGGGGTTGTTGGATCCGGAGGATGCGAGTTTGGATTTTGTGAAGAGGAGAGAGAATTTGAGACCTATGGCGT
TGTATAGGATTCAGAATGAGTTTTTGTTGTGTTATGATGGTGCGTTTTTTTTTTTTTTTCATGAACTCTTTTCTT
TTGGTTGATTTCCTTGGTTTTTCTTTTTACTAGAGTTTGCGTTTTATGTGAATAAGAGTGGGCAGAGGACACGTA
CGGAGTTTATGGTTCATTGGGAAGGACAACCCACAGGATTTGGTATGTCTTTCCTTCTCTTTTTTTTTACTGACG
AATTATGCTTATGATTATTATTAGCGTTACACGAGCCTTATATCCTCGCTTTCGAACCCAATTTTATCGAGATCC
GACATATAGAGACGGGATATCTAGCTCAAGTGATTCAAGGCTCAAATCTACGATTACTGTTTGCGGATTCGCCAC
CGACGAGTGGTCCGAAAGGGTCATTGTTGCATTCGCAACATTCACCAGGGATGATGATGTCATCGCCACATGGTG
GTTTTGGAGGGTATCCTCCTCCTCCTCCTCCTTCACAAGGACAAGGGTATTTGGGACAACCAGGAGGGGGAGGAT
TTGGGAGACAAGGTGGGGGGTTGAATGAAGGGAGAGATGAGATATTGGTGTGTTCGGATGATCGGGTGTTTGTGC
TTAGACCTGCTGTTGCTCGGCCTACGACAGGTGCTTCTATACCACCACAATTACAACCCCAAACGCAGCCACCGT
TGTCTGTTGGACAGGGTCATCAGAGTTCGATGTCGATGCCGGCGGATTTTTCGTGGACGTCGTTGACTCGATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail