Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091550
Gene name
Locationscaffold_6:863334..864020
Strand-
Gene length (bp)686
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP EXPERA (EXPanded EBP superfamily) 6.6E-26 35 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
sp|Q10255|YD27_SCHPO Uncharacterized membrane protein SPAC56F8.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.07 PE=3 SV=3 1 165 2.0E-10
sp|Q8VD00|TMM97_MOUSE Transmembrane protein 97 OS=Mus musculus GN=Tmem97 PE=1 SV=1 8 148 4.0E-10
sp|Q12155|YL050_YEAST Uncharacterized membrane protein YLR050C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR050C PE=1 SV=1 57 157 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22
2 68 90 22
3 97 119 22
4 139 161 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 48.06 24.18 71.95
Initials Initials knots 51.60 26.58 76.62
Pileal_Stipeal_center Stage I stipe center 81.64 44.36 118.92
Pileal_Stipeal_shell Stage I stipe shell 105.63 59.01 152.25
DIF_stipe_center Stage II stipe center 88.06 48.71 127.41
DIF_stipe_shell Stage II stipe shell 81.33 44.23 118.43
DIF_stipe_skin Stage II stipe skin 78.17 42.54 113.79
DIF_cap_skin Stage II cap skin 133.71 77.36 190.06
DIF_cap_tissue Stage II cap tissue 116.59 65.78 167.39
DIF_gill_tissue Stage II gill tissue 111.82 63.33 160.31
YFB_stipe_center Young fruiting body stipe center 89.48 49.59 129.37
YFB_stipe_shell Young fruiting body stipe shell 81.78 44.52 119.03
YFB_stipe_skin Young fruiting body stipe skin 74.58 40.27 108.88
YFB_cap_skin Young fruiting body cap skin 120.34 68.56 172.13
YFB_cap_tissue Young fruiting body cap tissue 122.88 70.16 175.61
YFB_gill_tissue Young fruiting body gill tissue 103.35 58.06 148.64
YFB_veil Young fruiting body veil 105.17 58.77 151.57

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.005671 yes
Casing YFB_stipe_center 0.053358 no
Casing YFB_stipe_shell 0.121717 no
Casing YFB_stipe_skin 0.229585 no
Casing YFB_cap_skin 0.002084 yes
Casing YFB_cap_tissue 0.002084 yes
Casing YFB_gill_tissue 0.012274 yes
Casing YFB_veil 0.011041 yes
Casing Initials 0.912268 no
Casing Pileal_Stipeal_center 0.122473 no
Casing Pileal_Stipeal_shell 0.011659 yes
Casing DIF_stipe_center 0.061473 no
Casing DIF_stipe_shell 0.124559 no
Casing DIF_stipe_skin 0.162227 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.004160 yes
DIF_gill_tissue YFB_stipe_center 0.581553 no
DIF_gill_tissue YFB_stipe_shell 0.401250 no
DIF_gill_tissue YFB_stipe_skin 0.228037 no
DIF_gill_tissue YFB_cap_skin 0.891825 no
DIF_gill_tissue YFB_cap_tissue 0.853681 no
DIF_gill_tissue YFB_gill_tissue 0.885780 no
DIF_gill_tissue YFB_veil 0.912975 no
YFB_stipe_center YFB_stipe_shell 0.872295 no
YFB_stipe_center YFB_stipe_skin 0.681947 no
YFB_stipe_center YFB_cap_skin 0.400535 no
YFB_stipe_center YFB_cap_tissue 0.359855 no
YFB_stipe_center YFB_gill_tissue 0.760040 no
YFB_stipe_center YFB_veil 0.715331 no
YFB_stipe_shell YFB_stipe_skin 0.869333 no
YFB_stipe_shell YFB_cap_skin 0.239857 no
YFB_stipe_shell YFB_cap_tissue 0.210892 no
YFB_stipe_shell YFB_gill_tissue 0.569760 no
YFB_stipe_shell YFB_veil 0.522533 no
YFB_stipe_skin YFB_cap_skin 0.119465 no
YFB_stipe_skin YFB_cap_tissue 0.102993 no
YFB_stipe_skin YFB_gill_tissue 0.366313 no
YFB_stipe_skin YFB_veil 0.327567 no
YFB_cap_skin YFB_cap_tissue 0.969739 no
YFB_cap_skin YFB_gill_tissue 0.735768 no
YFB_cap_skin YFB_veil 0.769834 no
YFB_cap_tissue YFB_gill_tissue 0.689953 no
YFB_cap_tissue YFB_veil 0.723535 no
YFB_gill_tissue YFB_veil 0.976614 no
Initials DIF_gill_tissue 0.009773 yes
Initials YFB_stipe_center 0.089641 no
Initials YFB_stipe_shell 0.192285 no
Initials YFB_stipe_skin 0.329846 no
Initials YFB_cap_skin 0.004160 yes
Initials YFB_cap_tissue 0.003365 yes
Initials YFB_gill_tissue 0.023153 yes
Initials YFB_veil 0.021583 yes
Initials Pileal_Stipeal_center 0.189035 no
Initials Pileal_Stipeal_shell 0.019715 yes
Initials DIF_stipe_center 0.104109 no
Initials DIF_stipe_shell 0.194007 no
Initials DIF_stipe_skin 0.248764 no
Initials DIF_cap_skin 0.001625 yes
Initials DIF_cap_tissue 0.007782 yes
Pileal_Stipeal_center DIF_gill_tissue 0.393342 no
Pileal_Stipeal_center YFB_stipe_center 0.869142 no
Pileal_Stipeal_center YFB_stipe_shell 0.997444 no
Pileal_Stipeal_center YFB_stipe_skin 0.873640 no
Pileal_Stipeal_center YFB_cap_skin 0.239428 no
Pileal_Stipeal_center YFB_cap_tissue 0.208336 no
Pileal_Stipeal_center YFB_gill_tissue 0.563702 no
Pileal_Stipeal_center YFB_veil 0.516659 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.521216 no
Pileal_Stipeal_center DIF_stipe_center 0.895747 no
Pileal_Stipeal_center DIF_stipe_shell 0.994825 no
Pileal_Stipeal_center DIF_stipe_skin 0.945713 no
Pileal_Stipeal_center DIF_cap_skin 0.110389 no
Pileal_Stipeal_center DIF_cap_tissue 0.306815 no
Pileal_Stipeal_shell DIF_gill_tissue 0.921517 no
Pileal_Stipeal_shell YFB_stipe_center 0.720499 no
Pileal_Stipeal_shell YFB_stipe_shell 0.530541 no
Pileal_Stipeal_shell YFB_stipe_skin 0.337772 no
Pileal_Stipeal_shell YFB_cap_skin 0.787102 no
Pileal_Stipeal_shell YFB_cap_tissue 0.742748 no
Pileal_Stipeal_shell YFB_gill_tissue 0.971082 no
Pileal_Stipeal_shell YFB_veil 0.993923 no
Pileal_Stipeal_shell DIF_stipe_center 0.684639 no
Pileal_Stipeal_shell DIF_stipe_shell 0.516552 no
Pileal_Stipeal_shell DIF_stipe_skin 0.435432 no
Pileal_Stipeal_shell DIF_cap_skin 0.553847 no
Pileal_Stipeal_shell DIF_cap_tissue 0.851128 no
DIF_stipe_center DIF_gill_tissue 0.546875 no
DIF_stipe_center YFB_stipe_center 0.978878 no
DIF_stipe_center YFB_stipe_shell 0.898091 no
DIF_stipe_center YFB_stipe_skin 0.722821 no
DIF_stipe_center YFB_cap_skin 0.366140 no
DIF_stipe_center YFB_cap_tissue 0.322431 no
DIF_stipe_center YFB_gill_tissue 0.728343 no
DIF_stipe_center YFB_veil 0.686242 no
DIF_stipe_center DIF_stipe_shell 0.888731 no
DIF_stipe_center DIF_stipe_skin 0.819195 no
DIF_stipe_center DIF_cap_skin 0.181328 no
DIF_stipe_center DIF_cap_tissue 0.445987 no
DIF_stipe_shell DIF_gill_tissue 0.383311 no
DIF_stipe_shell YFB_stipe_center 0.860905 no
DIF_stipe_shell YFB_stipe_shell 0.993103 no
DIF_stipe_shell YFB_stipe_skin 0.878312 no
DIF_stipe_shell YFB_cap_skin 0.229477 no
DIF_stipe_shell YFB_cap_tissue 0.199869 no
DIF_stipe_shell YFB_gill_tissue 0.551798 no
DIF_stipe_shell YFB_veil 0.506269 no
DIF_stipe_shell DIF_stipe_skin 0.950933 no
DIF_stipe_shell DIF_cap_skin 0.104748 no
DIF_stipe_shell DIF_cap_tissue 0.300398 no
DIF_stipe_skin DIF_gill_tissue 0.307289 no
DIF_stipe_skin YFB_stipe_center 0.784523 no
DIF_stipe_skin YFB_stipe_shell 0.941479 no
DIF_stipe_skin YFB_stipe_skin 0.937842 no
DIF_stipe_skin YFB_cap_skin 0.172824 no
DIF_stipe_skin YFB_cap_tissue 0.147277 no
DIF_stipe_skin YFB_gill_tissue 0.464638 no
DIF_stipe_skin YFB_veil 0.424353 no
DIF_stipe_skin DIF_cap_skin 0.072510 no
DIF_stipe_skin DIF_cap_tissue 0.229477 no
DIF_cap_skin DIF_gill_tissue 0.677796 no
DIF_cap_skin YFB_stipe_center 0.215044 no
DIF_cap_skin YFB_stipe_shell 0.123805 no
DIF_cap_skin YFB_stipe_skin 0.051932 no
DIF_cap_skin YFB_cap_skin 0.834077 no
DIF_cap_skin YFB_cap_tissue 0.871469 no
DIF_cap_skin YFB_gill_tissue 0.489964 no
DIF_cap_skin YFB_veil 0.525419 no
DIF_cap_skin DIF_cap_tissue 0.770622 no
DIF_cap_tissue DIF_gill_tissue 0.943212 no
DIF_cap_tissue YFB_stipe_center 0.490031 no
DIF_cap_tissue YFB_stipe_shell 0.322615 no
DIF_cap_tissue YFB_stipe_skin 0.173347 no
DIF_cap_tissue YFB_cap_skin 0.957023 no
DIF_cap_tissue YFB_cap_tissue 0.924139 no
DIF_cap_tissue YFB_gill_tissue 0.809453 no
DIF_cap_tissue YFB_veil 0.840224 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091550
MDLLYFGFFASHLFASLLLDLQWLYPASLVPKSLRALNEYYIVLSGDPLMGALAGLKHDFGMTWFKTFVTMEAFF
QVPVFILGLSALWKGSKKIYPLLLIYATSSATTTLPCLIYILSLPGPTPTTTPLDHTLTFEQRLVLLSGYGPFFL
VPLIMVFDFGSRLQKFVSQKPEQKLD*
Coding >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAATCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCTACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Transcript >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAATCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCTACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Gene >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGGTGCGTCGACTCCCAGAAACCCACCACCTTGCGTTCTTACATGAA
TTCTAGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATACCCAGCTTCCCTCGTCCCCAAATCA
TTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATGGGAGCACTCGCTGGCCTTAAACAT
GATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTAAGCCGCCTTACACACTGGCATTTGATAC
CGTTAATCATACTGTTTTACAGGTTTTTCCAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGTG
AGGACAACATCGTACAGGCTGCTCCTGGTAATTGCTCATTTCGTTTAGGCTCCAAGAAAATATACCCGCTCCTGC
TGATCTATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCC
CTACCACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCT
TCTTGGTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGA
AGTTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail