Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091550
Gene name
Locationscaffold_6:863334..864020
Strand-
Gene length (bp)686
Transcript length (bp)531
Coding sequence length (bp)531
Protein length (aa) 177

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF05241 EBP EXPERA (EXPanded EBP superfamily) 6.6E-26 35 158

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q3MHW7|TMM97_BOVIN Transmembrane protein 97 OS=Bos taurus GN=TMEM97 PE=2 SV=1 8 148 4.0E-12
sp|Q6DFQ5|TMM97_XENTR Transmembrane protein 97 OS=Xenopus tropicalis GN=tmem97 PE=2 SV=1 1 148 5.0E-12
sp|Q4R8A8|TMM97_MACFA Transmembrane protein 97 OS=Macaca fascicularis GN=Tmem97 PE=2 SV=2 8 156 7.0E-12
sp|Q5BJF2|TMM97_HUMAN Transmembrane protein 97 OS=Homo sapiens GN=TMEM97 PE=1 SV=1 8 156 8.0E-12
sp|Q5U3Y7|TMM97_RAT Transmembrane protein 97 OS=Rattus norvegicus GN=Tmem97 PE=2 SV=1 8 148 1.0E-10
sp|Q10255|YD27_SCHPO Uncharacterized membrane protein SPAC56F8.07 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC56F8.07 PE=3 SV=3 1 165 2.0E-10
sp|Q8VD00|TMM97_MOUSE Transmembrane protein 97 OS=Mus musculus GN=Tmem97 PE=1 SV=1 8 148 4.0E-10
sp|Q12155|YL050_YEAST Uncharacterized membrane protein YLR050C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YLR050C PE=1 SV=1 57 157 3.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 30 0.45

Transmembrane Domains

Domain # Start End Length
1 3 25 22
2 68 90 22
3 97 119 22
4 139 161 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091550
MDLLYFGFFASHLFASLLLDLQWLYPASLVPKSLRALNEYYIVLSGDPLMGALAGLKHDFGMTWFKTFVTMEAFF
QVPVFILGLSALWKGSKKIYPLLLIYATSSATTTLPCLIYILSLPGPTPTTTPLDHTLTFEQRLVLLSGYGPFFL
VPLIMVFDFGSRLQKFVSQKPEQKLD*
Coding >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAATCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCTACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Transcript >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATAC
CCAGCTTCCCTCGTCCCCAAATCATTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATG
GGAGCACTCGCTGGCCTTAAACATGATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTTTTTC
CAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGCTCCAAGAAAATATACCCGCTCCTGCTGATC
TATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCCCTACC
ACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCTTCTTG
GTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGAAGTTG
GACTGA
Gene >AgabiH97|091550
ATGGACTTGCTTTATTTCGGGTTCTTTGCGGTGCGTCGACTCCCAGAAACCCACCACCTTGCGTTCTTACATGAA
TTCTAGTCCCATTTATTTGCATCTCTTTTACTCGATCTTCAATGGTTATACCCAGCTTCCCTCGTCCCCAAATCA
TTGCGAGCGTTGAATGAATACTACATAGTGCTCTCGGGCGATCCGTTGATGGGAGCACTCGCTGGCCTTAAACAT
GATTTTGGTATGACTTGGTTCAAAACATTTGTCACAATGGAAGCGTAAGCCGCCTTACACACTGGCATTTGATAC
CGTTAATCATACTGTTTTACAGGTTTTTCCAAGTCCCAGTCTTTATACTCGGCTTGTCTGCTCTGTGGAAAGGTG
AGGACAACATCGTACAGGCTGCTCCTGGTAATTGCTCATTTCGTTTAGGCTCCAAGAAAATATACCCGCTCCTGC
TGATCTATGCCACATCCTCTGCAACCACAACACTTCCGTGCCTTATCTATATTTTGTCACTCCCAGGACCTACCC
CTACCACAACTCCTCTAGACCATACCCTCACATTCGAACAGCGCCTCGTACTACTTTCAGGCTACGGCCCATTCT
TCTTGGTTCCTCTGATCATGGTTTTTGACTTTGGCAGCCGTCTGCAGAAGTTTGTCTCACAAAAGCCCGAACAGA
AGTTGGACTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail