Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091490
Gene name
Locationscaffold_6:850163..850862
Strand+
Gene length (bp)699
Transcript length (bp)381
Coding sequence length (bp)381
Protein length (aa) 127

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01780 Ribosomal_L37ae Ribosomal L37ae protein family 1.1E-41 38 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 35 124 2.0E-46
sp|Q751L1|RL43_ASHGO 60S ribosomal protein L43 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL43 PE=3 SV=1 35 126 4.0E-46
sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 35 126 1.0E-45
sp|O61598|RL37A_OSTOS 60S ribosomal protein L37a OS=Ostertagia ostertagi GN=rpl-37a PE=3 SV=3 35 125 1.0E-45
sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 35 125 2.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q54UG4|RL37A_DICDI 60S ribosomal protein L37a OS=Dictyostelium discoideum GN=rpl37A PE=3 SV=1 35 124 2.0E-46
sp|Q751L1|RL43_ASHGO 60S ribosomal protein L43 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=RPL43 PE=3 SV=1 35 126 4.0E-46
sp|O61462|RL37A_CRYST 60S ribosomal protein L37a OS=Cryptochiton stelleri GN=RPL37A PE=3 SV=3 35 126 1.0E-45
sp|O61598|RL37A_OSTOS 60S ribosomal protein L37a OS=Ostertagia ostertagi GN=rpl-37a PE=3 SV=3 35 125 1.0E-45
sp|Q9VMU4|RL37A_DROME 60S ribosomal protein L37a OS=Drosophila melanogaster GN=RpL37A PE=1 SV=3 35 125 2.0E-45
sp|P0CX26|RL43B_YEAST 60S ribosomal protein L43-B OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43B PE=1 SV=1 35 126 9.0E-45
sp|P0CX25|RL43A_YEAST 60S ribosomal protein L43-A OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=RPL43A PE=1 SV=1 35 126 9.0E-45
sp|Q6FRG6|RL43_CANGA 60S ribosomal protein L43 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=RPL43 PE=3 SV=1 35 126 1.0E-44
sp|Q9XHE4|RL37A_GOSHI 60S ribosomal protein L37a OS=Gossypium hirsutum GN=RPL37A PE=3 SV=1 35 126 3.0E-43
sp|P32046|RL37A_CHICK 60S ribosomal protein L37a OS=Gallus gallus GN=RPL37A PE=3 SV=2 35 125 9.0E-43
sp|Q5QM99|RL37A_ORYSJ 60S ribosomal protein L37a OS=Oryza sativa subsp. japonica GN=Os01g0679700 PE=1 SV=1 35 126 1.0E-42
sp|P61515|RL37P_RAT Putative 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a-ps1 PE=5 SV=2 35 125 1.0E-42
sp|Q5RBF9|RL37A_PONAB 60S ribosomal protein L37a OS=Pongo abelii GN=RPL37A PE=3 SV=3 35 125 1.0E-42
sp|P61514|RL37A_MOUSE 60S ribosomal protein L37a OS=Mus musculus GN=Rpl37a PE=1 SV=2 35 125 1.0E-42
sp|P61513|RL37A_HUMAN 60S ribosomal protein L37a OS=Homo sapiens GN=RPL37A PE=1 SV=2 35 125 1.0E-42
sp|Q3MIC0|RL37A_BOVIN 60S ribosomal protein L37a OS=Bos taurus GN=RPL37A PE=3 SV=3 35 125 1.0E-42
sp|Q90YT0|RL37A_ICTPU 60S ribosomal protein L37a OS=Ictalurus punctatus GN=rpl37a PE=3 SV=3 35 125 5.0E-42
sp|Q9U2A8|RL37A_CAEEL 60S ribosomal protein L37a OS=Caenorhabditis elegans GN=rpl-43 PE=3 SV=3 35 125 1.0E-41
sp|Q7SZB4|RL37A_XENLA 60S ribosomal protein L37a OS=Xenopus laevis GN=rpl37a PE=3 SV=3 35 125 1.0E-41
sp|Q8RXU5|R37A2_ARATH 60S ribosomal protein L37a-2 OS=Arabidopsis thaliana GN=RPL37AC PE=3 SV=1 35 126 3.0E-41
sp|Q9ZRS8|RL37A_PSEMZ 60S ribosomal protein L37a OS=Pseudotsuga menziesii GN=RPL37A PE=3 SV=1 35 126 4.0E-41
sp|Q9SRK6|R37A1_ARATH Putative 60S ribosomal protein L37a-1 OS=Arabidopsis thaliana GN=RPL37AB PE=3 SV=1 35 126 4.0E-40
sp|P43209|RL37A_BRARR 60S ribosomal protein L37a OS=Brassica rapa subsp. rapa GN=RPL37A PE=3 SV=2 35 126 2.0E-39
sp|A4S6Z4|RL37A_OSTLU 60S ribosomal protein L37a OS=Ostreococcus lucimarinus (strain CCE9901) GN=RPL37a PE=3 SV=1 35 125 4.0E-39
sp|Q00VK4|RL37A_OSTTA 60S ribosomal protein L37a OS=Ostreococcus tauri GN=RPL37a PE=3 SV=2 35 125 3.0E-38
sp|Q9Y0H7|RL37A_MYXGL 60S ribosomal protein L37a (Fragment) OS=Myxine glutinosa GN=rpl37a PE=2 SV=1 42 125 2.0E-37
sp|Q23G98|RL37A_TETTS 60S ribosomal protein L37a OS=Tetrahymena thermophila (strain SB210) GN=RPL37A PE=1 SV=1 35 122 8.0E-37
sp|D4AAZ6|RL37A_RAT 60S ribosomal protein L37a OS=Rattus norvegicus GN=Rpl37a PE=1 SV=1 35 104 1.0E-33
sp|O17307|RL37A_SCHMA 60S ribosomal protein L37a (Fragment) OS=Schistosoma mansoni PE=2 SV=1 37 126 3.0E-33
sp|O94686|RL43B_SCHPO 60S ribosomal protein L43-B OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl4302 PE=3 SV=1 35 126 1.0E-32
sp|O96184|RL37A_PLAF7 60S ribosomal protein L37a OS=Plasmodium falciparum (isolate 3D7) GN=RPL37A PE=1 SV=1 35 125 1.0E-32
sp|Q9HGL8|RL43A_SCHPO 60S ribosomal protein L43-A OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rpl4301 PE=3 SV=1 35 126 2.0E-32
sp|A6NKH3|RL37L_HUMAN Putative 60S ribosomal protein L37a-like protein OS=Homo sapiens GN=RPL37AP8 PE=5 SV=2 35 125 2.0E-28
sp|P54051|RL37A_METJA 50S ribosomal protein L37Ae OS=Methanocaldococcus jannaschii (strain ATCC 43067 / DSM 2661 / JAL-1 / JCM 10045 / NBRC 100440) GN=rpl37ae PE=3 SV=1 35 125 3.0E-18
sp|Q8TZI4|RL37A_PYRFU 50S ribosomal protein L37Ae OS=Pyrococcus furiosus (strain ATCC 43587 / DSM 3638 / JCM 8422 / Vc1) GN=rpl37ae PE=1 SV=1 39 114 2.0E-17
sp|C6A452|RL37A_THESM 50S ribosomal protein L37Ae OS=Thermococcus sibiricus (strain MM 739 / DSM 12597) GN=rpl37ae PE=3 SV=1 38 117 9.0E-17
sp|Q8TYC3|RL37A_METKA 50S ribosomal protein L37Ae OS=Methanopyrus kandleri (strain AV19 / DSM 6324 / JCM 9639 / NBRC 100938) GN=rpl37ae PE=3 SV=1 38 122 1.0E-16
sp|B8D6B7|RL37A_DESK1 50S ribosomal protein L37Ae OS=Desulfurococcus kamchatkensis (strain 1221n / DSM 18924) GN=rpl37ae PE=3 SV=1 38 119 1.0E-16
sp|Q6M0M1|RL37A_METMP 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain S2 / LL) GN=rpl37ae PE=3 SV=1 39 122 3.0E-16
sp|A4FZT8|RL37A_METM5 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C5 / ATCC BAA-1333) GN=rpl37ae PE=3 SV=1 39 122 3.0E-16
sp|A5UNQ7|RL37A_METS3 50S ribosomal protein L37Ae OS=Methanobrevibacter smithii (strain PS / ATCC 35061 / DSM 861) GN=rpl37ae PE=3 SV=1 38 124 5.0E-16
sp|A6VIN8|RL37A_METM7 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C7 / ATCC BAA-1331) GN=rpl37ae PE=3 SV=1 39 122 5.0E-16
sp|A9A848|RL37A_METM6 50S ribosomal protein L37Ae OS=Methanococcus maripaludis (strain C6 / ATCC BAA-1332) GN=rpl37ae PE=3 SV=1 39 122 5.0E-16
sp|O26777|RL37A_METTH 50S ribosomal protein L37Ae OS=Methanothermobacter thermautotrophicus (strain ATCC 29096 / DSM 1053 / JCM 10044 / NBRC 100330 / Delta H) GN=rpl37ae PE=3 SV=1 38 120 6.0E-16
sp|A6URN7|RL37A_METVS 50S ribosomal protein L37Ae OS=Methanococcus vannielii (strain SB / ATCC 35089 / DSM 1224) GN=rpl37ae PE=3 SV=1 39 122 7.0E-16
sp|Q9HIP0|RL37A_THEAC 50S ribosomal protein L37Ae OS=Thermoplasma acidophilum (strain ATCC 25905 / DSM 1728 / JCM 9062 / NBRC 15155 / AMRC-C165) GN=rpl37ae PE=3 SV=1 35 104 9.0E-16
sp|Q2NEX3|RL37A_METST 50S ribosomal protein L37Ae OS=Methanosphaera stadtmanae (strain ATCC 43021 / DSM 3091 / JCM 11832 / MCB-3) GN=rpl37ae PE=3 SV=1 35 120 1.0E-15
sp|C5A4Z4|RL37A_THEGJ 50S ribosomal protein L37Ae OS=Thermococcus gammatolerans (strain DSM 15229 / JCM 11827 / EJ3) GN=rpl37ae PE=3 SV=1 38 117 1.0E-15
sp|Q5JDM6|RL37A_THEKO 50S ribosomal protein L37Ae OS=Thermococcus kodakarensis (strain ATCC BAA-918 / JCM 12380 / KOD1) GN=rpl37ae PE=3 SV=1 38 110 2.0E-15
sp|Q9V202|RL37A_PYRAB 50S ribosomal protein L37Ae OS=Pyrococcus abyssi (strain GE5 / Orsay) GN=rpl37ae PE=3 SV=1 39 117 2.0E-15
sp|O74106|RL37A_PYRHO 50S ribosomal protein L37Ae OS=Pyrococcus horikoshii (strain ATCC 700860 / DSM 12428 / JCM 9974 / NBRC 100139 / OT-3) GN=rpl37ae PE=3 SV=2 39 117 3.0E-15
sp|A6UTE9|RL37A_META3 50S ribosomal protein L37Ae OS=Methanococcus aeolicus (strain Nankai-3 / ATCC BAA-1280) GN=rpl37ae PE=3 SV=1 38 122 5.0E-15
sp|B6YTZ8|RL37A_THEON 50S ribosomal protein L37Ae OS=Thermococcus onnurineus (strain NA1) GN=rpl37ae PE=3 SV=1 38 110 5.0E-15
sp|Q97BZ3|RL37A_THEVO 50S ribosomal protein L37Ae OS=Thermoplasma volcanium (strain ATCC 51530 / DSM 4299 / JCM 9571 / NBRC 15438 / GSS1) GN=rpl37ae PE=3 SV=1 35 103 6.0E-15
sp|P60619|RL37A_HALMA 50S ribosomal protein L37Ae OS=Haloarcula marismortui (strain ATCC 43049 / DSM 3752 / JCM 8966 / VKM B-1809) GN=rpl37ae PE=1 SV=2 35 118 7.0E-15
sp|Q6L225|RL37A_PICTO 50S ribosomal protein L37Ae OS=Picrophilus torridus (strain ATCC 700027 / DSM 9790 / JCM 10055 / NBRC 100828) GN=rpl37ae PE=3 SV=1 35 109 1.0E-14
sp|Q9YC06|RL37A_AERPE 50S ribosomal protein L37Ae OS=Aeropyrum pernix (strain ATCC 700893 / DSM 11879 / JCM 9820 / NBRC 100138 / K1) GN=rpl37ae PE=3 SV=1 38 119 2.0E-14
sp|A1RSS8|RL37A_PYRIL 50S ribosomal protein L37Ae OS=Pyrobaculum islandicum (strain DSM 4184 / JCM 9189 / GEO3) GN=rpl37ae PE=3 SV=1 39 124 2.0E-14
sp|Q8ZVN1|RL37A_PYRAE 50S ribosomal protein L37Ae OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=rpl37ae PE=3 SV=1 39 107 1.0E-13
sp|Q74N55|RL37A_NANEQ 50S ribosomal protein L37Ae OS=Nanoarchaeum equitans (strain Kin4-M) GN=rpl37ae PE=3 SV=1 39 103 2.0E-13
sp|B1Y976|RL37A_PYRNV 50S ribosomal protein L37Ae OS=Pyrobaculum neutrophilum (strain DSM 2338 / JCM 9278 / V24Sta) GN=rpl37ae PE=3 SV=1 39 107 2.0E-13
sp|O30179|RL37A_ARCFU 50S ribosomal protein L37Ae OS=Archaeoglobus fulgidus (strain ATCC 49558 / VC-16 / DSM 4304 / JCM 9628 / NBRC 100126) GN=rpl37ae PE=3 SV=1 38 117 1.0E-12
sp|Q9HSG8|RL37A_HALSA 50S ribosomal protein L37Ae OS=Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) GN=rpl37ae PE=3 SV=2 42 118 1.0E-11
sp|B0R2Y1|RL37A_HALS3 50S ribosomal protein L37Ae OS=Halobacterium salinarum (strain ATCC 29341 / DSM 671 / R1) GN=rpl37ae PE=3 SV=1 42 118 1.0E-11
sp|Q97ZQ3|RL37A_SULSO 50S ribosomal protein L37Ae OS=Sulfolobus solfataricus (strain ATCC 35092 / DSM 1617 / JCM 11322 / P2) GN=rpl37ae PE=3 SV=2 40 104 3.0E-09
sp|Q975H0|RL37A_SULTO 50S ribosomal protein L37Ae OS=Sulfolobus tokodaii (strain DSM 16993 / JCM 10545 / NBRC 100140 / 7) GN=rpl37ae PE=3 SV=1 40 104 7.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003735 structural constituent of ribosome Yes
GO:0006412 translation Yes
GO:0005840 ribosome Yes
GO:1901576 organic substance biosynthetic process No
GO:0110165 cellular anatomical entity No
GO:0043229 intracellular organelle No
GO:0019538 protein metabolic process No
GO:0043603 cellular amide metabolic process No
GO:0008150 biological_process No
GO:0044271 cellular nitrogen compound biosynthetic process No
GO:0043232 intracellular non-membrane-bounded organelle No
GO:0071704 organic substance metabolic process No
GO:0043043 peptide biosynthetic process No
GO:1901564 organonitrogen compound metabolic process No
GO:0034645 cellular macromolecule biosynthetic process No
GO:0005575 cellular_component No
GO:0009058 biosynthetic process No
GO:0043604 amide biosynthetic process No
GO:0008152 metabolic process No
GO:1901566 organonitrogen compound biosynthetic process No
GO:0006518 peptide metabolic process No
GO:0043226 organelle No
GO:0043170 macromolecule metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0005198 structural molecule activity No
GO:0009059 macromolecule biosynthetic process No
GO:0043228 non-membrane-bounded organelle No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0009987 cellular process No
GO:0044237 cellular metabolic process No
GO:0044249 cellular biosynthetic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 39 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091490
MPCAVRDPPNVSPTVPNTDNRQDQRFANSNLPLKMTKRTKKVGITGKYGTRYGASLRKQVKKMEVSQHARYTCPF
CGKDSVKRTAVGVWNCKACRKTIAGGAWTVTTTAAATVRSTIRRLREINEA*
Coding >AgabiH97|091490
ATGCCTTGTGCTGTTCGGGATCCCCCGAACGTTTCGCCCACGGTACCCAACACTGACAATCGTCAAGACCAGCGC
TTCGCCAACAGTAATCTCCCTCTCAAAATGACAAAACGCACAAAGAAGGTCGGCATCACCGGAAAGTATGGTACC
CGTTATGGTGCCTCCTTAAGGAAACAAGTAAAGAAGATGGAAGTTTCTCAGCATGCTAGATACACATGCCCCTTC
TGCGGCAAGGACTCCGTAAAGAGGACTGCTGTGGGTGTCTGGAACTGCAAAGCCTGCAGAAAGACTATCGCTGGT
GGAGCTTGGACTGTAACGACGACCGCTGCTGCTACTGTGCGCAGCACGATTCGTCGGCTGCGTGAGATCAATGAG
GCTTAA
Transcript >AgabiH97|091490
ATGCCTTGTGCTGTTCGGGATCCCCCGAACGTTTCGCCCACGGTACCCAACACTGACAATCGTCAAGACCAGCGC
TTCGCCAACAGTAATCTCCCTCTCAAAATGACAAAACGCACAAAGAAGGTCGGCATCACCGGAAAGTATGGTACC
CGTTATGGTGCCTCCTTAAGGAAACAAGTAAAGAAGATGGAAGTTTCTCAGCATGCTAGATACACATGCCCCTTC
TGCGGCAAGGACTCCGTAAAGAGGACTGCTGTGGGTGTCTGGAACTGCAAAGCCTGCAGAAAGACTATCGCTGGT
GGAGCTTGGACTGTAACGACGACCGCTGCTGCTACTGTGCGCAGCACGATTCGTCGGCTGCGTGAGATCAATGAG
GCTTAA
Gene >AgabiH97|091490
ATGCCTTGTGGTTACTTTACTACACCATCACCATCATGACAAGATCAGATCTCGTGGCTGATCGAAAACTATACA
GCTGTTCGGGATCCCCCGAACGTTTCGCCCACGGTACCCAACACTGACAATCGTCAAGACCAGCGCTTCGCCAAC
AGTAATCTCCCTCTCAAAATGGTCAGTTTCTCTTGTGTTCCCGACTCATGTACCTTTACTCTGGCACAATGCTAA
CCATACTTGATTACTATAGACAAAACGCACAAAGAAGGTCGGCATCACCGGAAAGTATGGTACCGTAAGTATCGC
TCTTCAACCTACCGTCCAAAACACTGCAAATGAAACATTAAATCTGGTCTTTAGCGTTATGGTGCCTCCTTAAGG
AAACAAGTAAAGAAGATGGAAGTTTCTCAGCATGCTAGATACACATGCCCCTTCTGCGGCAAGGTATGTTACATT
CAAATACGGTCTTCTCTACGATTATATTGATTGTTTGGTGTTGTAGGACTCCGTAAAGAGGACTGCTGTGGGTGT
CTGGAACTGCAAAGCCTGCAGAAAGACTATCGCTGGTGGAGCTTGGACTGTAACGACGACCGCTGCTGCTACTGT
GCGCAGGTATGTGTTGCATCATATCCATAATTTGGCTTTGTATTAACAGTTAATCTTTATAGCACGATTCGTCGG
CTGCGTGAGATCAATGAGGCTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail