Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091180
Gene name
Locationscaffold_6:763292..764384
Strand+
Gene length (bp)1092
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 9.9E-14 57 167
PF13649 Methyltransf_25 Methyltransferase domain 8.5E-13 56 164
PF13847 Methyltransf_31 Methyltransferase domain 9.0E-10 55 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR5|MET13_MOUSE Methyltransferase-like protein 13 OS=Mus musculus GN=Mettl13 PE=1 SV=1 3 182 7.0E-37
sp|A5PK19|MET13_BOVIN Methyltransferase-like protein 13 OS=Bos taurus GN=METTL13 PE=2 SV=1 3 182 4.0E-35
sp|Q8N6R0|MET13_HUMAN Methyltransferase-like protein 13 OS=Homo sapiens GN=METTL13 PE=1 SV=1 3 182 2.0E-34
sp|Q29LW1|MTE13_DROPS Methyltransferase-like protein 13 OS=Drosophila pseudoobscura pseudoobscura GN=GA15401 PE=3 SV=1 3 190 4.0E-33
sp|Q9VIK9|MET13_DROME Methyltransferase-like protein 13 OS=Drosophila melanogaster GN=CG2614 PE=2 SV=1 3 190 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR5|MET13_MOUSE Methyltransferase-like protein 13 OS=Mus musculus GN=Mettl13 PE=1 SV=1 3 182 7.0E-37
sp|A5PK19|MET13_BOVIN Methyltransferase-like protein 13 OS=Bos taurus GN=METTL13 PE=2 SV=1 3 182 4.0E-35
sp|Q8N6R0|MET13_HUMAN Methyltransferase-like protein 13 OS=Homo sapiens GN=METTL13 PE=1 SV=1 3 182 2.0E-34
sp|Q29LW1|MTE13_DROPS Methyltransferase-like protein 13 OS=Drosophila pseudoobscura pseudoobscura GN=GA15401 PE=3 SV=1 3 190 4.0E-33
sp|Q9VIK9|MET13_DROME Methyltransferase-like protein 13 OS=Drosophila melanogaster GN=CG2614 PE=2 SV=1 3 190 3.0E-32
sp|A5WVX1|MET13_DANRE Methyltransferase-like protein 13 OS=Danio rerio GN=mettl13 PE=2 SV=1 3 175 2.0E-30
sp|Q6NTR1|MET13_XENLA Methyltransferase-like protein 13 OS=Xenopus laevis GN=mettl13 PE=2 SV=1 3 175 3.0E-30
sp|O60344|ECE2_HUMAN Endothelin-converting enzyme 2 OS=Homo sapiens GN=ECE2 PE=1 SV=4 6 155 3.0E-28
sp|Q10711|ECE2_BOVIN Endothelin-converting enzyme 2 OS=Bos taurus GN=ECE2 PE=1 SV=2 6 156 1.0E-27
sp|Q80Z60|ECE2_MOUSE Endothelin-converting enzyme 2 OS=Mus musculus GN=Ece2 PE=1 SV=2 6 156 1.0E-26
sp|Q5RCI5|MET12_PONAB Methyltransferase-like protein 12, mitochondrial OS=Pongo abelii GN=METTL12 PE=2 SV=1 16 205 2.0E-07
sp|Q9P7Z3|EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=see1 PE=2 SV=1 3 176 3.0E-07
sp|Q501S4|MET12_DANRE Methyltransferase-like protein 12, mitochondrial OS=Danio rerio GN=mettl12 PE=2 SV=2 16 192 6.0E-07
sp|Q5JPI9|MET10_HUMAN Protein-lysine N-methyltransferase METTL10 OS=Homo sapiens GN=METTL10 PE=1 SV=2 4 167 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 27.16 13.35 40.98
Initials Initials knots 32.64 16.70 48.59
Pileal_Stipeal_center Stage I stipe center 7.06 2.78 11.34
Pileal_Stipeal_shell Stage I stipe shell 7.34 3.00 11.67
DIF_stipe_center Stage II stipe center 7.41 2.92 11.90
DIF_stipe_shell Stage II stipe shell 4.55 1.61 7.49
DIF_stipe_skin Stage II stipe skin 6.40 2.46 10.33
DIF_cap_skin Stage II cap skin 3.63 1.19 6.06
DIF_cap_tissue Stage II cap tissue 4.88 1.77 7.98
DIF_gill_tissue Stage II gill tissue 4.83 1.75 7.91
YFB_stipe_center Young fruiting body stipe center 12.10 5.45 18.75
YFB_stipe_shell Young fruiting body stipe shell 8.96 3.79 14.13
YFB_stipe_skin Young fruiting body stipe skin 5.51 2.10 8.92
YFB_cap_skin Young fruiting body cap skin 5.20 1.96 8.43
YFB_cap_tissue Young fruiting body cap tissue 7.20 2.95 11.45
YFB_gill_tissue Young fruiting body gill tissue 5.04 1.86 8.23
YFB_veil Young fruiting body veil 5.01 1.80 8.22

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.018896 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.718491 no
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.022369 yes
DIF_gill_tissue YFB_stipe_shell 0.164366 no
DIF_gill_tissue YFB_stipe_skin 0.866443 no
DIF_gill_tissue YFB_cap_skin 0.933113 no
DIF_gill_tissue YFB_cap_tissue 0.445642 no
DIF_gill_tissue YFB_gill_tissue 0.960150 no
DIF_gill_tissue YFB_veil 0.968068 no
YFB_stipe_center YFB_stipe_shell 0.546815 no
YFB_stipe_center YFB_stipe_skin 0.045911 yes
YFB_stipe_center YFB_cap_skin 0.032742 yes
YFB_stipe_center YFB_cap_tissue 0.230656 no
YFB_stipe_center YFB_gill_tissue 0.025711 yes
YFB_stipe_center YFB_veil 0.027698 yes
YFB_stipe_shell YFB_stipe_skin 0.302114 no
YFB_stipe_shell YFB_cap_skin 0.237992 no
YFB_stipe_shell YFB_cap_tissue 0.720198 no
YFB_stipe_shell YFB_gill_tissue 0.207399 no
YFB_stipe_shell YFB_veil 0.203039 no
YFB_stipe_skin YFB_cap_skin 0.946455 no
YFB_stipe_skin YFB_cap_tissue 0.661956 no
YFB_stipe_skin YFB_gill_tissue 0.913519 no
YFB_stipe_skin YFB_veil 0.910268 no
YFB_cap_skin YFB_cap_tissue 0.562858 no
YFB_cap_skin YFB_gill_tissue 0.971752 no
YFB_cap_skin YFB_veil 0.967313 no
YFB_cap_tissue YFB_gill_tissue 0.518034 no
YFB_cap_tissue YFB_veil 0.510695 no
YFB_gill_tissue YFB_veil 0.994966 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.002525 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.000613 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.477859 no
Pileal_Stipeal_center YFB_stipe_center 0.197709 no
Pileal_Stipeal_center YFB_stipe_shell 0.677908 no
Pileal_Stipeal_center YFB_stipe_skin 0.682881 no
Pileal_Stipeal_center YFB_cap_skin 0.589880 no
Pileal_Stipeal_center YFB_cap_tissue 0.980836 no
Pileal_Stipeal_center YFB_gill_tissue 0.540630 no
Pileal_Stipeal_center YFB_veil 0.534557 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.961264 no
Pileal_Stipeal_center DIF_stipe_center 0.952225 no
Pileal_Stipeal_center DIF_stipe_shell 0.383882 no
Pileal_Stipeal_center DIF_stipe_skin 0.893575 no
Pileal_Stipeal_center DIF_cap_skin 0.146322 no
Pileal_Stipeal_center DIF_cap_tissue 0.495432 no
Pileal_Stipeal_shell DIF_gill_tissue 0.424488 no
Pileal_Stipeal_shell YFB_stipe_center 0.251432 no
Pileal_Stipeal_shell YFB_stipe_shell 0.746725 no
Pileal_Stipeal_shell YFB_stipe_skin 0.623158 no
Pileal_Stipeal_shell YFB_cap_skin 0.533228 no
Pileal_Stipeal_shell YFB_cap_tissue 0.981944 no
Pileal_Stipeal_shell YFB_gill_tissue 0.486577 no
Pileal_Stipeal_shell YFB_veil 0.479263 no
Pileal_Stipeal_shell DIF_stipe_center 0.989908 no
Pileal_Stipeal_shell DIF_stipe_shell 0.334715 no
Pileal_Stipeal_shell DIF_stipe_skin 0.847821 no
Pileal_Stipeal_shell DIF_cap_skin 0.125429 no
Pileal_Stipeal_shell DIF_cap_tissue 0.441846 no
DIF_stipe_center DIF_gill_tissue 0.405580 no
DIF_stipe_center YFB_stipe_center 0.262789 no
DIF_stipe_center YFB_stipe_shell 0.764392 no
DIF_stipe_center YFB_stipe_skin 0.605922 no
DIF_stipe_center YFB_cap_skin 0.513210 no
DIF_stipe_center YFB_cap_tissue 0.970918 no
DIF_stipe_center YFB_gill_tissue 0.468820 no
DIF_stipe_center YFB_veil 0.461733 no
DIF_stipe_center DIF_stipe_shell 0.318159 no
DIF_stipe_center DIF_stipe_skin 0.833349 no
DIF_stipe_center DIF_cap_skin 0.119761 no
DIF_stipe_center DIF_cap_tissue 0.422143 no
DIF_stipe_shell DIF_gill_tissue 0.945158 no
DIF_stipe_shell YFB_stipe_center 0.011041 yes
DIF_stipe_shell YFB_stipe_shell 0.114583 no
DIF_stipe_shell YFB_stipe_skin 0.785771 no
DIF_stipe_shell YFB_cap_skin 0.864937 no
DIF_stipe_shell YFB_cap_tissue 0.361938 no
DIF_stipe_shell YFB_gill_tissue 0.899083 no
DIF_stipe_shell YFB_veil 0.910001 no
DIF_stipe_shell DIF_stipe_skin 0.545703 no
DIF_stipe_shell DIF_cap_skin 0.745571 no
DIF_stipe_shell DIF_cap_tissue 0.935400 no
DIF_stipe_skin DIF_gill_tissue 0.640630 no
DIF_stipe_skin YFB_stipe_center 0.118547 no
DIF_stipe_skin YFB_stipe_shell 0.514626 no
DIF_stipe_skin YFB_stipe_skin 0.837876 no
DIF_stipe_skin YFB_cap_skin 0.755629 no
DIF_stipe_skin YFB_cap_tissue 0.873249 no
DIF_stipe_skin YFB_gill_tissue 0.705834 no
DIF_stipe_skin YFB_veil 0.698623 no
DIF_stipe_skin DIF_cap_skin 0.247691 no
DIF_stipe_skin DIF_cap_tissue 0.657358 no
DIF_cap_skin DIF_gill_tissue 0.661911 no
DIF_cap_skin YFB_stipe_center 0.003765 yes
DIF_cap_skin YFB_stipe_shell 0.036455 yes
DIF_cap_skin YFB_stipe_skin 0.454843 no
DIF_cap_skin YFB_cap_skin 0.549038 no
DIF_cap_skin YFB_cap_tissue 0.140001 no
DIF_cap_skin YFB_gill_tissue 0.596348 no
DIF_cap_skin YFB_veil 0.610721 no
DIF_cap_skin DIF_cap_tissue 0.648546 no
DIF_cap_tissue DIF_gill_tissue 0.991451 no
DIF_cap_tissue YFB_stipe_center 0.021322 yes
DIF_cap_tissue YFB_stipe_shell 0.167884 no
DIF_cap_tissue YFB_stipe_skin 0.877682 no
DIF_cap_tissue YFB_cap_skin 0.942426 no
DIF_cap_tissue YFB_cap_tissue 0.461599 no
DIF_cap_tissue YFB_gill_tissue 0.968938 no
DIF_cap_tissue YFB_veil 0.976025 no

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091180
MSMGVLPDTNEAYGAKEYWDQRYSQETENSDFDWFKSYKDLAEILHELIPNRMSRILMLGCGNSKLSEDMWEDGY
KHIVNTDYSKVLVENMKQRHGEARPEMEWYEMDVRDLKFDEESFDVAIDKGTMDAMMTIKGDVWDPPEQVIRDCN
KEVDEALRVLRKGGSFIYLTFGQPHFRRRYLARPDTTLEIRALGDAFHYYLYIVRKI*
Coding >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGGATCAAAGATACTCGCAA
GAAACCGAAAACTCGGATTTCGATTGGTTCAAATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCG
AACAGAATGTCCAGAATTCTGATGTTGGGCTGTGGTAATTCAAAGTTGTCTGAAGATATGTGGGAGGATGGGTAT
AAGCACATTGTCAATACCGATTATTCCAAAGTCTTAGTTGAAAACATGAAACAACGTCACGGCGAGGCACGACCA
GAGATGGAATGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATTGATAAA
GGGACTATGGATGCTATGATGACAATTAAGGGCGATGTATGGGATCCCCCAGAGCAAGTTATCAGAGATTGCAAT
AAAGAAGTTGATGAAGCCCTACGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTAACATTTGGTCAGCCACAC
TTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGAGATGCTTTCCATTATTAT
TTGTACATAGTTCGTAAGATTTGA
Transcript >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGGATCAAAGATACTCGCAA
GAAACCGAAAACTCGGATTTCGATTGGTTCAAATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCG
AACAGAATGTCCAGAATTCTGATGTTGGGCTGTGGTAATTCAAAGTTGTCTGAAGATATGTGGGAGGATGGGTAT
AAGCACATTGTCAATACCGATTATTCCAAAGTCTTAGTTGAAAACATGAAACAACGTCACGGCGAGGCACGACCA
GAGATGGAATGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATTGATAAA
GGGACTATGGATGCTATGATGACAATTAAGGGCGATGTATGGGATCCCCCAGAGCAAGTTATCAGAGATTGCAAT
AAAGAAGTTGATGAAGCCCTACGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTAACATTTGGTCAGCCACAC
TTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGAGATGCTTTCCATTATTAT
TTGTACATAGTTCGTAAGATTTGA
Gene >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGTAGGTCATATACATTGAT
AAACCCTCGAATTTCTATGTTCATGAAGATTATACAGGGATCAAAGATACTCGCAGTACGTCCAACAGATCGAAT
TTTGAAGGTATTGCGGCATGTAGAACTGATTTTCTCTTTACAGAGAAACCGAAAACTCGGATTTCGATTGGTTCA
AATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCGAACAGAATGTCCAGAATTCTGATGTTGGGCT
GTGGTAATTCAAAGTTGTCTGAAGATGTACGTACACTTTTTTCGCGCGTTCAGACTTGAAGAACGGAAAGGGATG
AGTCTTGACATTTTGAAGATGTGGGAGGATGGGTATAAGCACATTGTCAATACCGATGTGCGTTTTTCTTTTCCA
ATTGTCATTAAACCTGGAGCAGAATCAATCCTTTTTTTGAACAAAACTTCTGTAGTATTCCAAAGTCTTAGTTGA
AAACATGAAACAACGTCACGGCGAGGCACGACCAGAGATGGAATGTATGTCTTCTGTTTGAACAGATATAAGAAG
TTCAACGGGTTTGAAGGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATT
GATAAAGGTACGCCTCCTTTACCAATAGTCTTTGACGAACCCTTCTTTATCAATCTTACAAAGGGACTATGGATG
CTATGATGACAATTAAGGGCGATGTATGGGTAAGGCTGATGTTTACTATCCAACCCCGATCCATCATTTACTCAA
CACTTCTCAGGATCCCCCAGAGCAAGTTATCAGAGATTGCAATAAAGAAGTTGATGAAGCCCTACGGCGAGTTAA
ATCTCCCTCTCGATTATCCCACCATCTCATAAAAGCAAAAGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTA
ACATTTGGTCAGCCACACTTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGA
GATGCTTTCCATTATTATTTGTACATAGTTCGTAAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail