Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091180
Gene name
Locationscaffold_6:763292..764384
Strand+
Gene length (bp)1092
Transcript length (bp)624
Coding sequence length (bp)624
Protein length (aa) 208

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF08241 Methyltransf_11 Methyltransferase domain 9.9E-14 57 167
PF13649 Methyltransf_25 Methyltransferase domain 8.5E-13 56 164
PF13847 Methyltransf_31 Methyltransferase domain 9.0E-10 55 170

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR5|MET13_MOUSE Methyltransferase-like protein 13 OS=Mus musculus GN=Mettl13 PE=1 SV=1 3 182 7.0E-37
sp|A5PK19|MET13_BOVIN Methyltransferase-like protein 13 OS=Bos taurus GN=METTL13 PE=2 SV=1 3 182 4.0E-35
sp|Q8N6R0|MET13_HUMAN Methyltransferase-like protein 13 OS=Homo sapiens GN=METTL13 PE=1 SV=1 3 182 2.0E-34
sp|Q29LW1|MTE13_DROPS Methyltransferase-like protein 13 OS=Drosophila pseudoobscura pseudoobscura GN=GA15401 PE=3 SV=1 3 190 4.0E-33
sp|Q9VIK9|MET13_DROME Methyltransferase-like protein 13 OS=Drosophila melanogaster GN=CG2614 PE=2 SV=1 3 190 3.0E-32
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q91YR5|MET13_MOUSE Methyltransferase-like protein 13 OS=Mus musculus GN=Mettl13 PE=1 SV=1 3 182 7.0E-37
sp|A5PK19|MET13_BOVIN Methyltransferase-like protein 13 OS=Bos taurus GN=METTL13 PE=2 SV=1 3 182 4.0E-35
sp|Q8N6R0|MET13_HUMAN Methyltransferase-like protein 13 OS=Homo sapiens GN=METTL13 PE=1 SV=1 3 182 2.0E-34
sp|Q29LW1|MTE13_DROPS Methyltransferase-like protein 13 OS=Drosophila pseudoobscura pseudoobscura GN=GA15401 PE=3 SV=1 3 190 4.0E-33
sp|Q9VIK9|MET13_DROME Methyltransferase-like protein 13 OS=Drosophila melanogaster GN=CG2614 PE=2 SV=1 3 190 3.0E-32
sp|A5WVX1|MET13_DANRE Methyltransferase-like protein 13 OS=Danio rerio GN=mettl13 PE=2 SV=1 3 175 2.0E-30
sp|Q6NTR1|MET13_XENLA Methyltransferase-like protein 13 OS=Xenopus laevis GN=mettl13 PE=2 SV=1 3 175 3.0E-30
sp|O60344|ECE2_HUMAN Endothelin-converting enzyme 2 OS=Homo sapiens GN=ECE2 PE=1 SV=4 6 155 3.0E-28
sp|Q10711|ECE2_BOVIN Endothelin-converting enzyme 2 OS=Bos taurus GN=ECE2 PE=1 SV=2 6 156 1.0E-27
sp|Q80Z60|ECE2_MOUSE Endothelin-converting enzyme 2 OS=Mus musculus GN=Ece2 PE=1 SV=2 6 156 1.0E-26
sp|Q5RCI5|MET12_PONAB Methyltransferase-like protein 12, mitochondrial OS=Pongo abelii GN=METTL12 PE=2 SV=1 16 205 2.0E-07
sp|Q9P7Z3|EFM4_SCHPO Protein-lysine N-methyltransferase efm4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=see1 PE=2 SV=1 3 176 3.0E-07
sp|Q501S4|MET12_DANRE Methyltransferase-like protein 12, mitochondrial OS=Danio rerio GN=mettl12 PE=2 SV=2 16 192 6.0E-07
sp|Q5JPI9|MET10_HUMAN Protein-lysine N-methyltransferase METTL10 OS=Homo sapiens GN=METTL10 PE=1 SV=2 4 167 4.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 40 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091180
MSMGVLPDTNEAYGAKEYWDQRYSQETENSDFDWFKSYKDLAEILHELIPNRMSRILMLGCGNSKLSEDMWEDGY
KHIVNTDYSKVLVENMKQRHGEARPEMEWYEMDVRDLKFDEESFDVAIDKGTMDAMMTIKGDVWDPPEQVIRDCN
KEVDEALRVLRKGGSFIYLTFGQPHFRRRYLARPDTTLEIRALGDAFHYYLYIVRKI*
Coding >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGGATCAAAGATACTCGCAA
GAAACCGAAAACTCGGATTTCGATTGGTTCAAATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCG
AACAGAATGTCCAGAATTCTGATGTTGGGCTGTGGTAATTCAAAGTTGTCTGAAGATATGTGGGAGGATGGGTAT
AAGCACATTGTCAATACCGATTATTCCAAAGTCTTAGTTGAAAACATGAAACAACGTCACGGCGAGGCACGACCA
GAGATGGAATGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATTGATAAA
GGGACTATGGATGCTATGATGACAATTAAGGGCGATGTATGGGATCCCCCAGAGCAAGTTATCAGAGATTGCAAT
AAAGAAGTTGATGAAGCCCTACGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTAACATTTGGTCAGCCACAC
TTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGAGATGCTTTCCATTATTAT
TTGTACATAGTTCGTAAGATTTGA
Transcript >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGGATCAAAGATACTCGCAA
GAAACCGAAAACTCGGATTTCGATTGGTTCAAATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCG
AACAGAATGTCCAGAATTCTGATGTTGGGCTGTGGTAATTCAAAGTTGTCTGAAGATATGTGGGAGGATGGGTAT
AAGCACATTGTCAATACCGATTATTCCAAAGTCTTAGTTGAAAACATGAAACAACGTCACGGCGAGGCACGACCA
GAGATGGAATGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATTGATAAA
GGGACTATGGATGCTATGATGACAATTAAGGGCGATGTATGGGATCCCCCAGAGCAAGTTATCAGAGATTGCAAT
AAAGAAGTTGATGAAGCCCTACGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTAACATTTGGTCAGCCACAC
TTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGAGATGCTTTCCATTATTAT
TTGTACATAGTTCGTAAGATTTGA
Gene >AgabiH97|091180
ATGTCCATGGGCGTCCTCCCCGACACAAACGAAGCATACGGAGCAAAGGAATACTGGTAGGTCATATACATTGAT
AAACCCTCGAATTTCTATGTTCATGAAGATTATACAGGGATCAAAGATACTCGCAGTACGTCCAACAGATCGAAT
TTTGAAGGTATTGCGGCATGTAGAACTGATTTTCTCTTTACAGAGAAACCGAAAACTCGGATTTCGATTGGTTCA
AATCGTACAAGGATCTAGCTGAAATACTACACGAGCTCATTCCGAACAGAATGTCCAGAATTCTGATGTTGGGCT
GTGGTAATTCAAAGTTGTCTGAAGATGTACGTACACTTTTTTCGCGCGTTCAGACTTGAAGAACGGAAAGGGATG
AGTCTTGACATTTTGAAGATGTGGGAGGATGGGTATAAGCACATTGTCAATACCGATGTGCGTTTTTCTTTTCCA
ATTGTCATTAAACCTGGAGCAGAATCAATCCTTTTTTTGAACAAAACTTCTGTAGTATTCCAAAGTCTTAGTTGA
AAACATGAAACAACGTCACGGCGAGGCACGACCAGAGATGGAATGTATGTCTTCTGTTTGAACAGATATAAGAAG
TTCAACGGGTTTGAAGGGTACGAAATGGATGTCCGTGATCTAAAATTTGACGAGGAGTCATTTGATGTCGCGATT
GATAAAGGTACGCCTCCTTTACCAATAGTCTTTGACGAACCCTTCTTTATCAATCTTACAAAGGGACTATGGATG
CTATGATGACAATTAAGGGCGATGTATGGGTAAGGCTGATGTTTACTATCCAACCCCGATCCATCATTTACTCAA
CACTTCTCAGGATCCCCCAGAGCAAGTTATCAGAGATTGCAATAAAGAAGTTGATGAAGCCCTACGGCGAGTTAA
ATCTCCCTCTCGATTATCCCACCATCTCATAAAAGCAAAAGAGTGCTTCGCAAAGGTGGATCTTTTATTTATCTA
ACATTTGGTCAGCCACACTTCCGCCGAAGGTATTTGGCAAGACCAGACACAACTCTGGAAATTAGAGCTCTGGGA
GATGCTTTCCATTATTATTTGTACATAGTTCGTAAGATTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail