Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091140
Gene name
Locationscaffold_6:752999..754043
Strand+
Gene length (bp)1044
Transcript length (bp)984
Coding sequence length (bp)984
Protein length (aa) 328

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 1.0E-05 24 130

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 52 0.5

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091140
MSTASSRTPRLTIMAPEPFDHPDADVILRSSDKEPVDFRVFRLLLSLASPFFAVIFTLPQSNSPIRVEEYEDGVP
VIQMSEDKRTLNLLLQFCYPIALVDMPRLSSLQELQTIAQAALKFEIGGAQRFVRKTMLEARFIESQPLRVFAIA
CRFGWANEAKAAARYTLRQPLSNSAYFEELTQITAASYHRLQQYHRICGEVAASHVKMQPALAEFDDEWTWVQCQ
RCPGTNARASRDLGYPDSRRWFAGWVGDVAAEVQQRPWGVVVKKFDFREKAVSNARRCPICGPRAAGDLEAFSEM
LAVEIERELASIEIDVDFSQEAACGWD*
Coding >AgabiH97|091140
ATGTCGACTGCATCATCCAGAACGCCCCGGCTCACAATAATGGCGCCAGAACCATTTGACCACCCGGATGCCGAC
GTTATCCTCCGTTCCTCGGACAAGGAGCCTGTCGACTTCCGAGTCTTCAGACTATTGTTGTCTCTAGCATCGCCA
TTTTTCGCCGTGATCTTCACTCTTCCTCAATCAAATTCGCCCATCAGGGTGGAAGAATACGAGGATGGCGTACCT
GTCATTCAAATGTCGGAGGACAAACGGACCCTCAATCTTTTGTTGCAATTTTGTTATCCCATCGCGCTGGTTGAT
ATGCCCCGATTATCATCATTGCAGGAATTACAAACAATCGCGCAAGCTGCGCTGAAATTTGAAATCGGCGGAGCT
CAACGGTTTGTGAGGAAGACCATGTTGGAAGCCCGGTTCATAGAATCTCAGCCCCTGAGAGTATTCGCCATTGCA
TGTCGATTTGGATGGGCTAATGAGGCAAAGGCGGCGGCGCGATATACTCTCCGGCAACCACTTTCGAACTCGGCT
TATTTTGAAGAACTCACACAGATCACTGCGGCATCATATCACCGGTTACAACAATATCATCGGATCTGTGGTGAA
GTAGCTGCGTCTCATGTTAAAATGCAACCTGCGCTAGCAGAGTTTGACGACGAGTGGACCTGGGTCCAGTGTCAA
AGATGTCCCGGAACCAATGCTCGCGCGAGTAGGGATTTAGGATACCCGGATTCGCGCAGATGGTTTGCGGGATGG
GTTGGTGATGTTGCGGCAGAGGTTCAACAGCGACCATGGGGTGTAGTTGTGAAGAAATTTGATTTCAGAGAAAAA
GCCGTTTCAAATGCGCGGCGTTGTCCTATATGTGGACCGCGGGCAGCTGGAGATTTGGAGGCCTTCTCGGAGATG
CTGGCAGTTGAAATCGAAAGGGAGTTGGCTTCCATTGAAATAGATGTCGACTTTAGCCAGGAAGCTGCTTGTGGT
TGGGATTGA
Transcript >AgabiH97|091140
ATGTCGACTGCATCATCCAGAACGCCCCGGCTCACAATAATGGCGCCAGAACCATTTGACCACCCGGATGCCGAC
GTTATCCTCCGTTCCTCGGACAAGGAGCCTGTCGACTTCCGAGTCTTCAGACTATTGTTGTCTCTAGCATCGCCA
TTTTTCGCCGTGATCTTCACTCTTCCTCAATCAAATTCGCCCATCAGGGTGGAAGAATACGAGGATGGCGTACCT
GTCATTCAAATGTCGGAGGACAAACGGACCCTCAATCTTTTGTTGCAATTTTGTTATCCCATCGCGCTGGTTGAT
ATGCCCCGATTATCATCATTGCAGGAATTACAAACAATCGCGCAAGCTGCGCTGAAATTTGAAATCGGCGGAGCT
CAACGGTTTGTGAGGAAGACCATGTTGGAAGCCCGGTTCATAGAATCTCAGCCCCTGAGAGTATTCGCCATTGCA
TGTCGATTTGGATGGGCTAATGAGGCAAAGGCGGCGGCGCGATATACTCTCCGGCAACCACTTTCGAACTCGGCT
TATTTTGAAGAACTCACACAGATCACTGCGGCATCATATCACCGGTTACAACAATATCATCGGATCTGTGGTGAA
GTAGCTGCGTCTCATGTTAAAATGCAACCTGCGCTAGCAGAGTTTGACGACGAGTGGACCTGGGTCCAGTGTCAA
AGATGTCCCGGAACCAATGCTCGCGCGAGTAGGGATTTAGGATACCCGGATTCGCGCAGATGGTTTGCGGGATGG
GTTGGTGATGTTGCGGCAGAGGTTCAACAGCGACCATGGGGTGTAGTTGTGAAGAAATTTGATTTCAGAGAAAAA
GCCGTTTCAAATGCGCGGCGTTGTCCTATATGTGGACCGCGGGCAGCTGGAGATTTGGAGGCCTTCTCGGAGATG
CTGGCAGTTGAAATCGAAAGGGAGTTGGCTTCCATTGAAATAGATGTCGACTTTAGCCAGGAAGCTGCTTGTGGT
TGGGATTGA
Gene >AgabiH97|091140
ATGTCGACTGCATCATCCAGAACGCCCCGGCTCACAATAATGGCGCCAGAACCATTTGACCACCCGGATGCCGAC
GTTATCCTCCGTTCCTCGGACAAGGAGCCTGTCGACTTCCGAGTCTTCAGACTATTGTTGTCTCTAGCATCGCCA
TTTTTCGCCGTGATCTTCACTCTTCCTCAATCAAATTCGCCCATCAGGGTGGAAGAATACGAGGATGGCGTACCT
GTCATTCAAATGTCGGAGGACAAACGGACCCTCAATCTTTTGTTGCAATTTTGTTATCCCATCGCGCTGGTTGAT
ATGCCCCGATTATCATCATTGCAGGAATTACAAACAATCGCGCAAGCTGCGCTGAAATTTGAAATCGGCGGAGCT
CAACGGTTTGTGAGGAAGACCATGTTGGAAGCCCGGTTCATAGAATCTCAGCCCCTGAGAGTATTCGCCATTGCA
TGTCGATTTGGATGGGCTAATGAGGCAAAGGCGGCGGCGCGATATACTCTCCGGCAACCACTTTCGAACTCGGCT
TATTTTGAAGAACTCACACAGATCACTGCGGCATCATATCACCGGTTACAACAATATCATCGGATCTGTGGTGAA
GTAGCTGCGTCTCATGTTAAAATGCAACCTGCGCTAGCAGAGTTTGACGACGAGTGGACCTGGGTCCAGTGTCAA
AGATGTCCCGGAACCAATGCTCGCGCGAGTAGGGATTTAGGATACCCGGATTCGCGCAGATGGTTTGCGGGATGG
GTTGGTGATGTTGCGGCAGAGGTTCAACAGCGACCATGGGGTGTAGTTGTGAAGAAATTTGATTTCAGAGAAAAA
GCCGTTTCAAATGCGCGGCGTTGTCCTATATGTGGACCGCGGGCAGCTGGAGATTTGGAGGCCTTCTCGGAGATG
CTGGCAGTTGAAATCGAAAGGGAGTTGGCTTCCGTGCGTTTTACATACATTTACGTCGGAGACTCGCAGCTCAAT
TTTGCGTCTGACTTTCAGATTGAAATAGATGTCGACTTTAGCCAGGAAGCTGCTTGTGGTTGGGATTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail