Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|091110
Gene name
Locationscaffold_6:748493..749893
Strand+
Gene length (bp)1400
Transcript length (bp)1152
Coding sequence length (bp)1152
Protein length (aa) 384

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13639 zf-RING_2 Ring finger domain 6.4E-07 13 58
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 1.1E-06 12 61
PF13445 zf-RING_UBOX RING-type zinc-finger 1.4E-05 14 55
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 1.2E-05 14 57

Swissprot hits

(None)

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|091110
MSSIPSSLSVGGECPICLELKDINIFEVYPCGHCFCKPCLVNLQPPPNKRKISCPLCRRTFHRDLERSKLGFQPV
IYDSSNVGQVIEGINLMDKTCKTVSVKRAHNKLTKAAEEIDNDNAAKLLEAIEDFAKRIVPLFEEVELGRTRIQE
LENDQRHSSEHLTAKSRQVESLQQQCFELHSSNGVLEQKFLDALESAELLQTKTEESQRQLMEVKKGLVMREEEH
RQAIDSLKRFKISDERKSEKVRGLKREVIELSQKLRQVREVREEEQDSRMDVDQEHKPTTTAPFGTNTHLPGLSS
SNIAVADEGWNVTRNFGFEGMPRPGFGSRRDVDSKKMNRLTKKQPPGGSKASSNFPLNLDAKGRPKAAVHIGPKS
TIRVAQRF*
Coding >AgabiH97|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGAATTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGACATTGTTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGG
AAAATCAGTTGTCCACTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTT
ATTTACGATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGC
GTCAAACGTGCTCATAATAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGCTAAACTGCTTGAA
GCTATTGAAGATTTTGCGAAGCGGATAGTTCCCCTTTTTGAGGAGGTAGAGCTAGGAAGAACGAGGATACAAGAA
CTTGAAAATGACCAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAA
TGTTTCGAACTTCATAGTTCAAACGGTGTACTTGAACAAAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTA
CAAACCAAAACTGAAGAATCTCAACGGCAATTGATGGAGGTGAAAAAAGGTCTTGTGATGAGAGAAGAGGAACAT
AGACAGGCCATAGATTCGTTGAAAAGGTTCAAGATCTCGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAG
AGAGAGGTGATCGAGTTGAGTCAGAAGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCACGGATG
GATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCAATACTCATTTACCTGGCCTCTCGTCT
TCTAATATAGCTGTAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGATTTGAAGGCATGCCCCGACCTGGT
TTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAAAACAGCCACCTGGCGGCTCCAAG
GCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTGCAGTTCATATCGGACCAAAGTCG
ACCATCCGCGTCGCTCAACGATTCTGA
Transcript >AgabiH97|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGAATTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGACATTGTTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGG
AAAATCAGTTGTCCACTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTT
ATTTACGATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGC
GTCAAACGTGCTCATAATAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGCTAAACTGCTTGAA
GCTATTGAAGATTTTGCGAAGCGGATAGTTCCCCTTTTTGAGGAGGTAGAGCTAGGAAGAACGAGGATACAAGAA
CTTGAAAATGACCAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAA
TGTTTCGAACTTCATAGTTCAAACGGTGTACTTGAACAAAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTA
CAAACCAAAACTGAAGAATCTCAACGGCAATTGATGGAGGTGAAAAAAGGTCTTGTGATGAGAGAAGAGGAACAT
AGACAGGCCATAGATTCGTTGAAAAGGTTCAAGATCTCGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAG
AGAGAGGTGATCGAGTTGAGTCAGAAGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCACGGATG
GATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCAATACTCATTTACCTGGCCTCTCGTCT
TCTAATATAGCTGTAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGATTTGAAGGCATGCCCCGACCTGGT
TTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAAAACAGCCACCTGGCGGCTCCAAG
GCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTGCAGTTCATATCGGACCAAAGTCG
ACCATCCGCGTCGCTCAACGATTCTGA
Gene >AgabiH97|091110
ATGTCCTCTATCCCCTCATCGCTCTCTGTTGGTGGCGAGTGCCCCATCTGCTTGGAATTAAAAGACATCAACATT
TTCGAAGTATATCCTTGTGGCAAGTCTGTTCCTTTTGCGTCCTGGACTCCCCCCGAGATATATATCTAACATATT
ATAAAACGTTGTAGGACATTGTTTTTGTAAACCCTGTCTCGTCAATCTCCAACCACCACCCAATAAAAGGAAAAT
CAGTTGTCCACTATGTCGAAGGACATTCCACAGAGACCTGGAAAGAAGTAAACTTGGATTCCAACCGGTTATTTA
CGATTCGAGCAATGTCGGACAAGTCATAGAAGGGATTAACCTCATGGATAAGACGTGTAAAACGGTTAGCGTCAA
ACGTGCTCATAATAAATTGACCAAGGCGGCGGAAGAGATCGATAATGATAATGCGGTGCGCTATATCACTATATA
ATTGGTTCTCGTCCCTTTTCTCAAGTAACCTTTGCGTTTGTGCGTATAGGCTAAACTGCTTGAAGCTATTGAAGA
TTTTGCGAAGCGGATAGTTCCCCTTTTTGAGGAGGTAGAGCTAGGAAGAACGAGGATACAAGAACTTGAAAATGA
CCAGCGTCACTCCTCTGAGCATCTTACAGCAAAATCACGTCAAGTTGAATCACTTCAACAACAATGTTTCGAACT
TCATAGTTCAAACGGTGTACTTGAACAAAAATTCCTTGATGCGCTGGAATCTGCCGAACTCTTACAAACCAAAAC
TGAAGAATCTCAACGGCAATTGATGGAGGTGAAAAAAGGTCTTGTGATGAGAGAAGAGGAACATAGACAGGCCAT
AGATTCGTTGAAAAGGTTCAAGATCTCGGTGAGCGACAATGGTTTCACATTTCGAGCCTTGTTTGTTGATGGTAG
CTTCCTGTTTATTAGGATGAAAGAAAGTCGGAGAAAGTCAGAGGTCTAAAGAGAGAGGTGATCGAGTTGAGTCAG
AAGCTGCGACAAGTGAGAGAAGTGAGAGAAGAAGAGCAGGATTCACGGATGGTAAGAGATTTTGAATTTCGGAAG
AAAAAGTGTCTCAACTCGGCCAGGATGTCGATCAAGAACATAAACCTACTACCACGGCACCTTTCGGAACCAATA
CTCATTTACCTGGCCTCTCGTCTTCTAATATAGCTGTAGCAGATGAGGGATGGAATGTCACTCGAAACTTTGGAT
TTGAAGGCATGCCCCGACCTGGTTTCGGTTCCAGGAGGGACGTAGACAGCAAGAAGATGAACCGTCTAACCAAAA
AACAGCCACCTGGCGGCTCCAAGGCCAGTTCGAACTTTCCCTTAAACCTCGACGCGAAAGGACGGCCAAAGGCTG
CAGTTCATATCGGACCAAAGTCGACCATCCGCGTCGCTCAACGATTCTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail