Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090950
Gene name
Locationscaffold_6:710311..715901
Strand+
Gene length (bp)5590
Transcript length (bp)4695
Coding sequence length (bp)4695
Protein length (aa) 1565

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00621 RhoGEF RhoGEF domain 2.2E-28 529 715
PF00621 RhoGEF RhoGEF domain 6.5E-31 759 937
PF00780 CNH CNH domain 3.8E-55 1182 1463
PF15405 PH_5 Pleckstrin homology domain 1.4E-17 983 1120

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 750 1468 4.0E-77
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 737 1468 6.0E-69
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 751 1461 2.0E-68
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 733 1475 7.0E-60
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 733 1461 5.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 750 1468 4.0E-77
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 737 1468 6.0E-69
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 751 1461 2.0E-68
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 733 1475 7.0E-60
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 733 1461 5.0E-45
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 346 708 5.0E-36
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 456 711 2.0E-27
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 457 758 2.0E-26
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 349 695 6.0E-24
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 457 711 2.0E-23
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 739 1119 4.0E-18
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 739 1119 5.0E-18
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 753 1018 5.0E-17
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 756 1017 6.0E-17
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 737 1059 3.0E-16
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 737 1059 3.0E-16
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 737 1059 3.0E-16
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 737 1042 5.0E-16
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 468 717 7.0E-16
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 753 1018 2.0E-15
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 737 1059 2.0E-15
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 507 717 6.0E-15
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 756 952 7.0E-14
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 756 952 7.0E-14
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 737 1123 2.0E-13
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 753 1361 5.0E-13
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 749 1114 3.0E-12
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 753 1016 1.0E-11
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 753 1016 1.0E-11
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 507 729 2.0E-11
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 515 714 4.0E-11
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 515 714 4.0E-11
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 752 1034 4.0E-11
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 753 1016 5.0E-11
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 757 1034 5.0E-11
sp|Q5JSP0|FGD3_HUMAN FYVE, RhoGEF and PH domain-containing protein 3 OS=Homo sapiens GN=FGD3 PE=1 SV=1 759 1016 8.0E-11
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 737 1043 9.0E-11
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 516 709 1.0E-10
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 507 695 1.0E-10
sp|O88842|FGD3_MOUSE FYVE, RhoGEF and PH domain-containing protein 3 OS=Mus musculus GN=Fgd3 PE=1 SV=1 759 1016 1.0E-10
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 756 1023 1.0E-10
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 737 1043 2.0E-10
sp|P98174|FGD1_HUMAN FYVE, RhoGEF and PH domain-containing protein 1 OS=Homo sapiens GN=FGD1 PE=1 SV=2 759 1016 3.0E-10
sp|P52734|FGD1_MOUSE FYVE, RhoGEF and PH domain-containing protein 1 OS=Mus musculus GN=Fgd1 PE=1 SV=2 759 1016 3.0E-10
sp|Q5R5T1|FGD3_PONAB FYVE, RhoGEF and PH domain-containing protein 3 OS=Pongo abelii GN=FGD3 PE=2 SV=1 759 1016 3.0E-10
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 507 695 4.0E-10
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 737 988 4.0E-10
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 749 1114 4.0E-10
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 740 988 4.0E-10
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 756 1021 5.0E-10
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 526 694 6.0E-10
sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 749 1021 7.0E-10
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 736 1044 1.0E-09
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 737 988 2.0E-09
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 752 1022 2.0E-09
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 756 1021 3.0E-09
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 756 1021 4.0E-09
sp|E9Q7D5|ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus GN=Arhgef5 PE=1 SV=1 749 1114 4.0E-09
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 750 1019 4.0E-09
sp|Q9ULL1|PKHG1_HUMAN Pleckstrin homology domain-containing family G member 1 OS=Homo sapiens GN=PLEKHG1 PE=1 SV=2 759 1031 7.0E-09
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 752 1048 9.0E-09
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 516 709 1.0E-08
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 526 740 1.0E-08
sp|Q21653|OSG1_CAEEL Rho guanine nucleotide exchange factor osg-1 OS=Caenorhabditis elegans GN=osg-1 PE=2 SV=4 746 926 1.0E-08
sp|Q66T02|PKHG5_MOUSE Pleckstrin homology domain-containing family G member 5 OS=Mus musculus GN=Plekhg5 PE=1 SV=1 737 1049 1.0E-08
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 737 988 2.0E-08
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 737 988 2.0E-08
sp|Q8BWA8|ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus GN=Arhgef19 PE=1 SV=1 749 1021 2.0E-08
sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=1 SV=2 752 1022 2.0E-08
sp|Q6RFZ7|PKHG5_RAT Pleckstrin homology domain-containing family G member 5 OS=Rattus norvegicus GN=Plekhg5 PE=1 SV=1 737 1049 2.0E-08
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 752 1022 2.0E-08
sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 752 1022 2.0E-08
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 755 987 4.0E-08
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 755 987 4.0E-08
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 756 1023 4.0E-08
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 494 740 5.0E-08
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 755 987 5.0E-08
sp|O94827|PKHG5_HUMAN Pleckstrin homology domain-containing family G member 5 OS=Homo sapiens GN=PLEKHG5 PE=1 SV=3 737 1049 5.0E-08
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 751 922 6.0E-08
sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 495 717 7.0E-08
sp|Q8IW93|ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens GN=ARHGEF19 PE=1 SV=1 749 1021 7.0E-08
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 749 956 1.0E-07
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 749 985 3.0E-07
sp|E9Q7D5|ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus GN=Arhgef5 PE=1 SV=1 495 717 4.0E-07
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 742 961 4.0E-07
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 526 700 5.0E-07
sp|Q0KL02|TRIO_MOUSE Triple functional domain protein OS=Mus musculus GN=Trio PE=1 SV=3 751 922 7.0E-07
sp|O75962|TRIO_HUMAN Triple functional domain protein OS=Homo sapiens GN=TRIO PE=1 SV=2 751 922 9.0E-07
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 517 722 1.0E-06
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 517 722 1.0E-06
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 517 722 1.0E-06
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 507 708 1.0E-06
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 526 781 1.0E-06
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 471 711 1.0E-06
sp|Q45FX5|VAV_CAEEL Protein vav-1 OS=Caenorhabditis elegans GN=vav-1 PE=1 SV=1 755 937 1.0E-06
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 526 727 1.0E-06
sp|Q9NXL2|ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens GN=ARHGEF38 PE=2 SV=2 738 961 2.0E-06
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 496 711 2.0E-06
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 737 915 3.0E-06
sp|A2CG49|KALRN_MOUSE Kalirin OS=Mus musculus GN=Kalrn PE=1 SV=1 756 1043 3.0E-06
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 490 729 3.0E-06
sp|Q4VAC9|PKHG3_MOUSE Pleckstrin homology domain-containing family G member 3 OS=Mus musculus GN=Plekhg3 PE=1 SV=2 759 1045 3.0E-06
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 517 722 4.0E-06
sp|P97924|KALRN_RAT Kalirin OS=Rattus norvegicus GN=Kalrn PE=1 SV=3 756 1043 4.0E-06
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 526 712 4.0E-06
sp|Q9QX73|ARHG9_RAT Rho guanine nucleotide exchange factor 9 OS=Rattus norvegicus GN=Arhgef9 PE=1 SV=1 526 754 4.0E-06
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 526 712 4.0E-06
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 680 1006 4.0E-06
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 507 708 5.0E-06
sp|O60229|KALRN_HUMAN Kalirin OS=Homo sapiens GN=KALRN PE=1 SV=2 756 1043 5.0E-06
sp|Q3KR16|PKHG6_HUMAN Pleckstrin homology domain-containing family G member 6 OS=Homo sapiens GN=PLEKHG6 PE=1 SV=3 737 1049 5.0E-06
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 529 714 5.0E-06
sp|A1L390|PKHG3_HUMAN Pleckstrin homology domain-containing family G member 3 OS=Homo sapiens GN=PLEKHG3 PE=1 SV=1 759 1045 5.0E-06
sp|Q9NHV9|VAV_DROME Protein vav OS=Drosophila melanogaster GN=Vav PE=1 SV=2 755 1122 6.0E-06
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 526 781 8.0E-06
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 526 785 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030695 GTPase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 36 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090950
MVMAINSSIPPDPPHEEIHDVYEEFKHANEAKEAEYVVSSPYSDFQGPSDLAFTKRPSPWSPQPSSPSSVNTTAS
RSFPTSHASTLPPVPPPVPPPPPSGSSSSGLRGRPLPRPPTASNAIISPVPSTSIPARVDPYPLVVASPQPSYSK
YQETSENYVDHSPVSDLPSSSGFNGQLAGTDGEVSDEGSDDTDYIDDTGEKIPPLPPYSQNIGREILLAVGPSPD
TRSPSLAESNSLGIVSEHMTFSSSEGRNFHFVPSDPGPSNYRDHRSFGGGNSYGDHESSAVFYETHSRDYDDDIY
RGDHRASQGAGLGRRNSRYILVGHMEDDEASGHWDEPSDEDDANFINYSFLSNLAMLLRDKVPRDEHTKGRITYP
NSFTGKDIVTTVHYQIYRELKENHGAAVEDRRPALLVARSLQTQLFFYEVEWGSQVLQDGVGDVYMFLDDPQDDS
ERTEIPTGVVTVLSKCYSPSCGEFDDSYCYSYSCPRRGLKQLPPMTEALSGPTQDPWPISVPQDLLQSLTEFEIN
RQTIIHKLLSKEEQYVHDLDLVESVFIEPLRNSGIQASSGSLQEFMDEIFGNIMQIRDINKRLLESLYVRQREQA
PVVKEIGDIFLAAAIHDFREAYPLYIGHQPIAERLMREELETNSAFRIFIEECSRSQVVRLGQSPRLDLKHFLNR
PVEHLQKYRVLLEAIYKETDQGNSDGSFVAEAIKALNTLHNLAQVHTFQETVMKGSLKKWEWSDLVTRSERQYFS
REEAQRQSIIFELIATEMDYVKDLHNIDKMFITPLREADPSIIPRDRLPQFLNEVFNNIQDVTFHHQRLVDQLHY
IQREHHPRIPSITAAVFSTALDFREAYLKYIPNYPIAAYRIEDERENNAAFRAFHDDAIRHSSARRLPMNHFIYR
PIPRLTRYELLLRGILDATPPGHEDRSAIPQVIETLKLLGKDTEPGVASAKQKVDLWKYNDLILFKQGEHFDMDL
LNDSRSLIHSGKLYRQAEGGVAIGRGDLAELFVILFDNYLLMTKAKPKEETMEYHVTRRPIPLDLLLLVKFDEPP
VQRPTGLLRTRRGDRSATSPTGSHPNRSDSVDSNLLYPFVLHHTGRLGGQCVLYAESASVRTEWQKKLEETLGLR
TVVMESNKMFEMETLSQETFLLPAFPGTQVVPTWSDTTTLGGKVTCSVPFTTRDNRKLVAMACAEGVWMGFLHDP
RSMRRVLHLRNVTQCAMLEDFGLFLVLADKTLFAYHIEALVPTQPYGPLVPVDYQRVNSAGKDVQFFSVGTMNNR
TLVVYMRKSRGSESFFHALEPVADKIGERPKTSSGITSIFKNKSSWFRTYKEFTLPGECYDFIFLKTRIAIPCQK
GFEIMQIETMISVTIPVIQDSRLTTRCGSARPLGMFRVNDDEFILCYDEFGLFVNRKGDPSRKNSTVEWEGTADH
VALHAPYILLFDSRFIEVRHVDTGRLAQIIPGTDVRCVWDGRGTDQSPALMMAPGPHENMSQEPKVHAVMSVSTD
QQYPSSGRSHRGVYQHVFELVPTIPLYLPDPIASPPAATQFLHPSYSPPRSPLSRPGGSLSYRS*
Coding >AgabiH97|090950
ATGGTCATGGCTATTAACTCGTCCATCCCTCCGGATCCGCCACATGAAGAGATCCATGATGTTTATGAAGAATTC
AAACATGCAAACGAAGCAAAAGAGGCCGAATATGTTGTTTCCTCGCCATATTCCGACTTTCAGGGCCCCAGTGAC
CTTGCTTTCACCAAACGCCCTTCCCCGTGGTCTCCTCAACCATCTTCGCCCAGCAGTGTGAACACGACAGCTTCA
CGATCATTTCCTACGTCTCATGCCTCGACTCTGCCTCCCGTCCCGCCTCCCGTCCCGCCTCCCCCACCCTCGGGG
TCCTCATCAAGCGGCCTCCGAGGGAGGCCTCTTCCACGCCCTCCAACAGCTTCGAATGCCATCATCAGCCCAGTT
CCCAGCACATCCATTCCAGCTCGCGTCGATCCGTATCCACTCGTCGTAGCCTCTCCACAGCCGAGCTACAGCAAA
TATCAAGAGACTTCCGAGAATTATGTCGACCATTCACCTGTCTCAGACCTGCCGTCATCTTCTGGATTCAATGGC
CAACTAGCTGGGACAGATGGTGAGGTTAGTGACGAAGGAAGTGATGATACAGATTATATCGACGATACAGGAGAA
AAGATACCGCCGCTGCCGCCATATAGCCAGAACATCGGCCGCGAAATTTTATTGGCAGTTGGACCATCACCGGAT
ACGCGATCGCCTTCCCTCGCTGAGTCGAACTCGCTCGGTATTGTAAGCGAGCACATGACTTTTAGTAGTTCCGAA
GGGAGGAACTTTCACTTCGTTCCATCCGATCCTGGTCCTTCTAACTACAGAGATCACCGGAGCTTTGGCGGAGGA
AACAGCTACGGTGACCATGAATCTTCTGCTGTATTCTATGAGACGCATAGTCGCGATTATGACGATGATATCTAT
AGAGGAGATCATCGAGCGTCCCAGGGTGCGGGCCTCGGGCGCCGCAACTCTAGATACATCCTGGTCGGGCACATG
GAGGATGATGAAGCCTCCGGCCACTGGGACGAGCCGTCTGATGAGGATGATGCGAACTTTATCAATTATTCTTTC
CTATCTAACCTTGCCATGCTCCTGCGTGATAAAGTTCCCCGAGATGAGCATACCAAAGGAAGAATCACGTATCCT
AATTCCTTCACCGGAAAAGACATTGTAACAACGGTTCACTACCAAATATATCGCGAATTAAAAGAAAACCACGGC
GCCGCAGTGGAGGACCGACGACCTGCTCTCCTCGTCGCACGGAGCCTCCAAACTCAGCTCTTCTTTTACGAGGTT
GAGTGGGGTAGTCAAGTTCTCCAAGACGGCGTCGGTGACGTGTACATGTTCTTGGATGACCCACAGGATGACTCA
GAAAGGACGGAAATACCAACGGGGGTTGTCACTGTCCTAAGTAAATGTTATTCTCCCAGTTGTGGAGAGTTTGAC
GATAGTTACTGCTATTCATACTCGTGTCCTCGCCGGGGACTTAAGCAGCTTCCTCCGATGACAGAAGCGTTATCA
GGGCCCACACAAGATCCTTGGCCTATATCTGTCCCGCAAGATTTGCTCCAGTCGCTCACAGAATTTGAAATAAAT
CGGCAAACAATCATACATAAACTCTTGAGCAAGGAAGAACAATATGTTCATGATCTTGACCTAGTGGAATCAGTT
TTCATCGAGCCTTTACGCAATTCTGGTATACAAGCTAGTTCCGGGAGTTTGCAGGAGTTTATGGACGAGATATTC
GGCAACATAATGCAAATACGGGATATTAACAAGCGGCTCCTGGAGTCCCTATATGTCCGCCAAAGAGAGCAAGCA
CCAGTTGTAAAGGAAATTGGCGATATATTCTTGGCTGCTGCAATTCATGATTTTAGGGAAGCCTATCCGCTTTAC
ATAGGACATCAGCCTATTGCGGAGCGGTTAATGCGAGAAGAGCTCGAAACCAACTCAGCTTTTAGGATATTCATC
GAGGAGTGTTCTCGGAGTCAAGTAGTCCGCCTGGGACAATCACCGCGACTTGATCTCAAACACTTTTTGAACCGG
CCAGTGGAGCATCTCCAGAAATACAGAGTATTGTTGGAGGCCATATACAAGGAAACGGACCAGGGAAACTCTGAT
GGTAGTTTCGTGGCTGAAGCTATCAAGGCACTTAACACACTTCACAATTTAGCCCAAGTCCATACATTCCAAGAG
ACTGTGATGAAGGGATCGCTGAAAAAGTGGGAGTGGTCAGATCTTGTGACACGATCCGAGAGGCAGTATTTCTCC
AGGGAAGAAGCACAACGCCAATCAATCATCTTCGAACTCATTGCGACCGAGATGGACTATGTTAAAGATCTACAT
AACATAGACAAGATGTTTATAACGCCGTTACGAGAAGCGGATCCTTCGATTATCCCGCGGGATAGACTCCCTCAA
TTTCTGAATGAAGTGTTTAACAACATTCAAGACGTCACTTTCCACCACCAACGCCTCGTTGATCAGCTTCATTAC
ATTCAACGTGAACACCATCCACGGATCCCGAGCATTACCGCTGCTGTTTTCAGTACAGCTCTCGATTTCAGAGAG
GCCTATTTGAAGTACATTCCGAACTATCCTATTGCAGCTTATCGCATTGAAGACGAAAGAGAGAACAACGCTGCT
TTTCGCGCTTTTCATGATGACGCGATACGGCACTCAAGTGCTCGGAGACTGCCAATGAATCACTTCATTTACCGA
CCAATACCTCGATTAACGCGATATGAATTATTGCTCAGAGGAATTCTTGACGCTACTCCTCCTGGGCACGAAGAT
AGGAGCGCGATCCCTCAAGTCATAGAAACCCTCAAACTGTTAGGCAAAGATACAGAACCCGGGGTTGCGTCAGCC
AAGCAGAAGGTTGATTTATGGAAGTACAACGACTTAATCTTATTCAAACAAGGGGAACATTTCGATATGGATCTA
CTAAACGATTCGCGGTCGCTTATACATTCTGGTAAATTATACCGTCAGGCTGAAGGAGGTGTTGCCATCGGTCGG
GGCGATTTGGCAGAATTATTTGTCATCCTTTTTGACAACTACCTTCTGATGACGAAGGCCAAACCAAAAGAAGAG
ACGATGGAATACCATGTTACCCGACGACCAATTCCTCTCGACCTACTGTTGTTGGTCAAATTTGACGAACCACCA
GTTCAGCGTCCAACTGGCCTCTTACGTACCCGCCGTGGCGATCGAAGTGCTACCAGTCCGACGGGGTCACATCCC
AATCGAAGTGACAGTGTAGATTCTAATTTATTATATCCCTTTGTTCTCCACCATACGGGCCGATTGGGTGGACAG
TGCGTTTTGTACGCTGAATCAGCATCGGTGCGAACTGAATGGCAGAAGAAATTAGAGGAAACTTTGGGATTGCGG
ACAGTAGTCATGGAATCGAACAAAATGTTCGAAATGGAGACATTGAGCCAAGAGACATTCTTGCTGCCAGCCTTC
CCGGGTACTCAAGTTGTACCAACGTGGAGTGATACAACAACCTTGGGTGGTAAAGTAACTTGTTCAGTGCCATTC
ACCACGCGGGATAATCGTAAACTTGTGGCTATGGCTTGTGCCGAAGGTGTCTGGATGGGCTTTCTTCATGATCCC
CGGTCTATGCGTCGCGTGCTTCATCTGCGAAATGTGACTCAGTGTGCCATGCTCGAGGATTTTGGGCTTTTCCTG
GTCCTCGCTGACAAAACCCTGTTTGCTTATCATATCGAAGCTTTAGTGCCCACTCAGCCATATGGTCCACTTGTG
CCAGTTGACTATCAGCGGGTGAATTCTGCAGGGAAAGATGTCCAGTTCTTTTCGGTTGGGACCATGAACAACCGA
ACACTGGTAGTTTACATGAGGAAGTCGAGAGGGTCGGAAAGCTTTTTTCACGCTTTGGAGCCTGTCGCCGACAAG
ATTGGGGAACGCCCAAAGACAAGCTCGGGTATTACCTCGATCTTCAAAAACAAGTCTAGCTGGTTCCGAACGTAT
AAAGAATTCACTCTACCCGGAGAATGCTACGATTTCATTTTCCTCAAAACGAGGATTGCAATACCTTGTCAGAAG
GGTTTCGAAATCATGCAGATTGAAACTATGATCAGCGTCACGATACCTGTAATACAAGACTCCCGACTTACTACG
CGTTGTGGATCTGCTCGGCCGCTAGGTATGTTCCGAGTCAATGATGATGAGTTTATCCTTTGTTATGACGAATTT
GGACTGTTTGTCAATAGAAAAGGGGATCCTTCGCGAAAGAACTCAACAGTTGAATGGGAAGGCACTGCCGATCAC
GTCGCCCTCCATGCTCCTTACATTCTCCTCTTCGATTCTCGTTTCATCGAAGTTAGGCATGTCGATACTGGCCGC
CTAGCTCAAATTATACCCGGGACTGATGTTCGATGTGTATGGGATGGGCGTGGCACTGATCAATCTCCAGCGTTG
ATGATGGCTCCAGGACCCCACGAGAATATGTCTCAAGAACCTAAAGTTCACGCCGTTATGAGTGTGAGCACGGAT
CAACAATACCCATCTAGCGGAAGAAGTCATCGAGGGGTGTACCAACACGTCTTTGAACTTGTTCCAACTATACCC
TTGTATCTACCTGACCCAATTGCGTCACCTCCTGCGGCAACACAATTCCTTCATCCTTCGTATTCGCCGCCGAGA
TCCCCGCTTTCACGACCTGGAGGAAGTTTAAGTTATCGCTCGTAG
Transcript >AgabiH97|090950
ATGGTCATGGCTATTAACTCGTCCATCCCTCCGGATCCGCCACATGAAGAGATCCATGATGTTTATGAAGAATTC
AAACATGCAAACGAAGCAAAAGAGGCCGAATATGTTGTTTCCTCGCCATATTCCGACTTTCAGGGCCCCAGTGAC
CTTGCTTTCACCAAACGCCCTTCCCCGTGGTCTCCTCAACCATCTTCGCCCAGCAGTGTGAACACGACAGCTTCA
CGATCATTTCCTACGTCTCATGCCTCGACTCTGCCTCCCGTCCCGCCTCCCGTCCCGCCTCCCCCACCCTCGGGG
TCCTCATCAAGCGGCCTCCGAGGGAGGCCTCTTCCACGCCCTCCAACAGCTTCGAATGCCATCATCAGCCCAGTT
CCCAGCACATCCATTCCAGCTCGCGTCGATCCGTATCCACTCGTCGTAGCCTCTCCACAGCCGAGCTACAGCAAA
TATCAAGAGACTTCCGAGAATTATGTCGACCATTCACCTGTCTCAGACCTGCCGTCATCTTCTGGATTCAATGGC
CAACTAGCTGGGACAGATGGTGAGGTTAGTGACGAAGGAAGTGATGATACAGATTATATCGACGATACAGGAGAA
AAGATACCGCCGCTGCCGCCATATAGCCAGAACATCGGCCGCGAAATTTTATTGGCAGTTGGACCATCACCGGAT
ACGCGATCGCCTTCCCTCGCTGAGTCGAACTCGCTCGGTATTGTAAGCGAGCACATGACTTTTAGTAGTTCCGAA
GGGAGGAACTTTCACTTCGTTCCATCCGATCCTGGTCCTTCTAACTACAGAGATCACCGGAGCTTTGGCGGAGGA
AACAGCTACGGTGACCATGAATCTTCTGCTGTATTCTATGAGACGCATAGTCGCGATTATGACGATGATATCTAT
AGAGGAGATCATCGAGCGTCCCAGGGTGCGGGCCTCGGGCGCCGCAACTCTAGATACATCCTGGTCGGGCACATG
GAGGATGATGAAGCCTCCGGCCACTGGGACGAGCCGTCTGATGAGGATGATGCGAACTTTATCAATTATTCTTTC
CTATCTAACCTTGCCATGCTCCTGCGTGATAAAGTTCCCCGAGATGAGCATACCAAAGGAAGAATCACGTATCCT
AATTCCTTCACCGGAAAAGACATTGTAACAACGGTTCACTACCAAATATATCGCGAATTAAAAGAAAACCACGGC
GCCGCAGTGGAGGACCGACGACCTGCTCTCCTCGTCGCACGGAGCCTCCAAACTCAGCTCTTCTTTTACGAGGTT
GAGTGGGGTAGTCAAGTTCTCCAAGACGGCGTCGGTGACGTGTACATGTTCTTGGATGACCCACAGGATGACTCA
GAAAGGACGGAAATACCAACGGGGGTTGTCACTGTCCTAAGTAAATGTTATTCTCCCAGTTGTGGAGAGTTTGAC
GATAGTTACTGCTATTCATACTCGTGTCCTCGCCGGGGACTTAAGCAGCTTCCTCCGATGACAGAAGCGTTATCA
GGGCCCACACAAGATCCTTGGCCTATATCTGTCCCGCAAGATTTGCTCCAGTCGCTCACAGAATTTGAAATAAAT
CGGCAAACAATCATACATAAACTCTTGAGCAAGGAAGAACAATATGTTCATGATCTTGACCTAGTGGAATCAGTT
TTCATCGAGCCTTTACGCAATTCTGGTATACAAGCTAGTTCCGGGAGTTTGCAGGAGTTTATGGACGAGATATTC
GGCAACATAATGCAAATACGGGATATTAACAAGCGGCTCCTGGAGTCCCTATATGTCCGCCAAAGAGAGCAAGCA
CCAGTTGTAAAGGAAATTGGCGATATATTCTTGGCTGCTGCAATTCATGATTTTAGGGAAGCCTATCCGCTTTAC
ATAGGACATCAGCCTATTGCGGAGCGGTTAATGCGAGAAGAGCTCGAAACCAACTCAGCTTTTAGGATATTCATC
GAGGAGTGTTCTCGGAGTCAAGTAGTCCGCCTGGGACAATCACCGCGACTTGATCTCAAACACTTTTTGAACCGG
CCAGTGGAGCATCTCCAGAAATACAGAGTATTGTTGGAGGCCATATACAAGGAAACGGACCAGGGAAACTCTGAT
GGTAGTTTCGTGGCTGAAGCTATCAAGGCACTTAACACACTTCACAATTTAGCCCAAGTCCATACATTCCAAGAG
ACTGTGATGAAGGGATCGCTGAAAAAGTGGGAGTGGTCAGATCTTGTGACACGATCCGAGAGGCAGTATTTCTCC
AGGGAAGAAGCACAACGCCAATCAATCATCTTCGAACTCATTGCGACCGAGATGGACTATGTTAAAGATCTACAT
AACATAGACAAGATGTTTATAACGCCGTTACGAGAAGCGGATCCTTCGATTATCCCGCGGGATAGACTCCCTCAA
TTTCTGAATGAAGTGTTTAACAACATTCAAGACGTCACTTTCCACCACCAACGCCTCGTTGATCAGCTTCATTAC
ATTCAACGTGAACACCATCCACGGATCCCGAGCATTACCGCTGCTGTTTTCAGTACAGCTCTCGATTTCAGAGAG
GCCTATTTGAAGTACATTCCGAACTATCCTATTGCAGCTTATCGCATTGAAGACGAAAGAGAGAACAACGCTGCT
TTTCGCGCTTTTCATGATGACGCGATACGGCACTCAAGTGCTCGGAGACTGCCAATGAATCACTTCATTTACCGA
CCAATACCTCGATTAACGCGATATGAATTATTGCTCAGAGGAATTCTTGACGCTACTCCTCCTGGGCACGAAGAT
AGGAGCGCGATCCCTCAAGTCATAGAAACCCTCAAACTGTTAGGCAAAGATACAGAACCCGGGGTTGCGTCAGCC
AAGCAGAAGGTTGATTTATGGAAGTACAACGACTTAATCTTATTCAAACAAGGGGAACATTTCGATATGGATCTA
CTAAACGATTCGCGGTCGCTTATACATTCTGGTAAATTATACCGTCAGGCTGAAGGAGGTGTTGCCATCGGTCGG
GGCGATTTGGCAGAATTATTTGTCATCCTTTTTGACAACTACCTTCTGATGACGAAGGCCAAACCAAAAGAAGAG
ACGATGGAATACCATGTTACCCGACGACCAATTCCTCTCGACCTACTGTTGTTGGTCAAATTTGACGAACCACCA
GTTCAGCGTCCAACTGGCCTCTTACGTACCCGCCGTGGCGATCGAAGTGCTACCAGTCCGACGGGGTCACATCCC
AATCGAAGTGACAGTGTAGATTCTAATTTATTATATCCCTTTGTTCTCCACCATACGGGCCGATTGGGTGGACAG
TGCGTTTTGTACGCTGAATCAGCATCGGTGCGAACTGAATGGCAGAAGAAATTAGAGGAAACTTTGGGATTGCGG
ACAGTAGTCATGGAATCGAACAAAATGTTCGAAATGGAGACATTGAGCCAAGAGACATTCTTGCTGCCAGCCTTC
CCGGGTACTCAAGTTGTACCAACGTGGAGTGATACAACAACCTTGGGTGGTAAAGTAACTTGTTCAGTGCCATTC
ACCACGCGGGATAATCGTAAACTTGTGGCTATGGCTTGTGCCGAAGGTGTCTGGATGGGCTTTCTTCATGATCCC
CGGTCTATGCGTCGCGTGCTTCATCTGCGAAATGTGACTCAGTGTGCCATGCTCGAGGATTTTGGGCTTTTCCTG
GTCCTCGCTGACAAAACCCTGTTTGCTTATCATATCGAAGCTTTAGTGCCCACTCAGCCATATGGTCCACTTGTG
CCAGTTGACTATCAGCGGGTGAATTCTGCAGGGAAAGATGTCCAGTTCTTTTCGGTTGGGACCATGAACAACCGA
ACACTGGTAGTTTACATGAGGAAGTCGAGAGGGTCGGAAAGCTTTTTTCACGCTTTGGAGCCTGTCGCCGACAAG
ATTGGGGAACGCCCAAAGACAAGCTCGGGTATTACCTCGATCTTCAAAAACAAGTCTAGCTGGTTCCGAACGTAT
AAAGAATTCACTCTACCCGGAGAATGCTACGATTTCATTTTCCTCAAAACGAGGATTGCAATACCTTGTCAGAAG
GGTTTCGAAATCATGCAGATTGAAACTATGATCAGCGTCACGATACCTGTAATACAAGACTCCCGACTTACTACG
CGTTGTGGATCTGCTCGGCCGCTAGGTATGTTCCGAGTCAATGATGATGAGTTTATCCTTTGTTATGACGAATTT
GGACTGTTTGTCAATAGAAAAGGGGATCCTTCGCGAAAGAACTCAACAGTTGAATGGGAAGGCACTGCCGATCAC
GTCGCCCTCCATGCTCCTTACATTCTCCTCTTCGATTCTCGTTTCATCGAAGTTAGGCATGTCGATACTGGCCGC
CTAGCTCAAATTATACCCGGGACTGATGTTCGATGTGTATGGGATGGGCGTGGCACTGATCAATCTCCAGCGTTG
ATGATGGCTCCAGGACCCCACGAGAATATGTCTCAAGAACCTAAAGTTCACGCCGTTATGAGTGTGAGCACGGAT
CAACAATACCCATCTAGCGGAAGAAGTCATCGAGGGGTGTACCAACACGTCTTTGAACTTGTTCCAACTATACCC
TTGTATCTACCTGACCCAATTGCGTCACCTCCTGCGGCAACACAATTCCTTCATCCTTCGTATTCGCCGCCGAGA
TCCCCGCTTTCACGACCTGGAGGAAGTTTAAGTTATCGCTCGTAG
Gene >AgabiH97|090950
ATGGTCATGGCTATTAACTCGTCCATCCCTCCGGATCCGCCACATGAAGAGATCCATGATGTTTATGAAGAATTC
AAACATGCAAACGAAGCAAAAGAGGCCGAATATGTTGTTTCCTCGCCATATTCCGACTTTCAGGGCCCCAGTGAC
CTTGCTTTCACCAAACGCCCTTCCCCGTGGTCTCCTCAACCATCTTCGCCCAGCAGTGTGAACACGAGTGAGTCG
GCTGTATGCATCAGTGGTAGATTAACTACTTATGGATTTTAAGCAGCTTCACGATCATTTCCTACGTCTCATGCC
TCGACTCTGCCTCCCGTCCCGCCTCCCGTCCCGCCTCCCCCACCCTCGGGGTCCTCATCAAGCGGCCTCCGAGGG
AGGCCTCTTCCACGCCCTCCAACAGCTTCGAATGCCATCATCAGCCCAGTTCCCAGCACATCCATTCCAGCTCGC
GTCGATCCGTATCCACTCGTCGTAGCCTCTCCACAGCCGAGCTACAGCAAATATCAAGAGACTTCCGAGAATTAT
GTCGACCATTCACCTGTCTCAGACCTGCCGTCATCTTCTGGATTCAATGGCCAACTAGCTGGGACAGATGGTGAG
GTTAGTGACGAAGGAAGTGATGATACAGATTATATCGACGATACAGGAGAAAAGATACCGCCGCTGCCGCCATAT
AGCCAGAACATCGGCCGCGAAATTTTATTGGCAGTTGGACCATCACCGGATACGCGATCGCCTTCCCTCGCTGAG
TCGAACTCGCTCGGTATTGTAAGCGAGCACATGACTTTTAGTAAGTCGCAGCCTCTACAGAATGGCAGTATGCTT
AATTTATGTAGGTAGTTCCGAAGGGAGGAACTTTCACTTCGTTCCATCCGATCCTGGTCCTTCTAACTACAGAGA
TCACCGGAGCTTTGGCGGAGGAAACAGCTACGGTGACCATGAATCTTCTGCTGTATTCTATGAGACGCATAGTCG
CGATTATGACGATGATATCTATAGAGGAGATCATCGAGCGTCCCAGGGTGCGGGCCTCGGGCGCCGCAACTCTAG
ATACATCCTGGTCGGGCACATGGAGGATGATGAAGCCTCCGGCCACTGGGACGAGCCGTCTGATGAGGATGATGC
GAACTTTATCAATTATTCTTTCCTATCTAACCTTGCCATGCTCCTGCGTGATAAAGTTCCCCGAGATGAGCATAC
CAAAGGAAGAATCACGTATCCTAATTCCTTCACCGGAAAAGACATTGTAGTAGGTCATTGCCACATATTATGTGT
ATTTTTGAAGCTGATCAATTGACAGACAACGGTTCACTACCAAATATATCGCGAATTAAAAGAAAACCACGGCGC
CGCAGTGGAGGACCGACGACCTGCTCTCCTCGTCGCACGGAGCCTCCAAACTCAGCTCTTCTTTTACGAGGTTGA
GTGGGGTAGTCAAGTTCTCCAAGACGGCGTCGGTGACGTGTACATGTTCTTGGATGACCCACAGGATGACTCAGA
AAGGACGGAAATACCAACGGGGGTTGTCACTGTCCTAAGTAAATGTTATTCTCCCAGTTGTGGAGAGTTTGACGA
TAGTTACTGCTATTCATACTCGTGTCCTCGCCGGGTGAGTATTCATTTGAGTTTTGTCACCTTCTGGTCACCCTC
CTCTGATGCATCATATATCACGCAGGGACTTAAGCAGCTTCCTCCGATGACAGAAGCGTTATCAGGGCCCACACA
AGATCCTTGGCCTATATCTGTCCCGCAAGATTTGCTCCAGTCGCTCACAGAATTTGAAATAAATCGGCAAACGTA
GGTTTACCCCAAACTCGTTGGTTTAGCATACCTGACTTTGAAGAACCCTCCAGAATCATACATAAACTCTTGAGC
AAGGAAGAACAATATGTTCATGATCTTGACCTAGTGGAATCAGTTTTCATCGAGCCTTTACGCAATTCTGGTATA
CAAGCTAGTTCCGGGAGTTTGCAGGAGTTTATGGACGAGATATTCGGCAACATAATGCAAATACGGGATATTAAC
AAGCGGCTCCTGGAGTCCCTATATGTCCGCCAAAGAGAGCAAGCACCAGTTGTAAAGGAAATTGGCGATATATTC
TTGGCTGCTGCAATTCATGATTTTAGGGAAGCCTATCCGCTTTACATAGGACATCAGCCTATTGCGGAGCGGTTA
ATGCGAGAAGAGCTCGAAACCAACTCAGCTTTTAGGATATTCATCGAGGTTCGCATGAGCATTGCTATCTGGCGG
CTTTTACTTATAACTCTGGCTAGGAGTGTTCTCGGAGTCAAGTAGTCCGCCTGGGACAATCACCGCGACTTGATC
TCAAACACTTTTTGAACCGGCCAGTGGAGCATCTCCAGAAATACAGAGTATTGTTGGAGGCCATATACAAGGAAA
CGGACCAGGGAAACTCTGATGGTAGTTTCGTGGCTGAAGCTATCAAGGCACTTAACACACTTCACAATTTAGCCC
AAGTCCATACATTCCAAGAGACTGTGATGAAGGGATCGCTGAAAAAGTGGGAGTGGTCAGATCTTGTGACACGAT
CCGAGAGGCAGTATTTCTCCAGGGAAGAAGCACAACGCCAATCGTGAGTGTAATCTTTACCTGTCCAATCCTGGC
TTACACTTGTGTAGAATCATCTTCGAACTCATTGCGACCGAGATGGACTATGTTAAAGATCTACATAACATAGAC
AAGGTAATTAAATCTCTTTACTTTTTTTATTTAACCGCTATTGACAGGTTTTGTAGATGTTTATAACGCCGTTAC
GAGAAGCGGATCCTTCGATTATCCCGCGGGATAGACTCCCTCAATTTCTGAATGAAGTGTTTAACAACATTCAAG
ACGTCACTTTCCACCACCAACGCCTCGTTGATCAGCTTCATTACATTCAACGTGAACACCATCCACGGATCCCGA
GCATTACCGCTGCTGTTTTCAGTACAGCTCTCGATTTCAGAGAGGCCTATTTGAAGTACATTCCGAACTATCCTA
TTGCAGCTTATCGCATTGAAGACGAAAGAGAGAACAACGCTGCTTTTCGCGCTTTTCATGATGTGAGTTTATATA
GCCGATCAGCGATGCAATATTTACTTAAATGAAATCAGGACGCGATACGGCACTCAAGTGCTCGGAGACTGCCAA
TGAATCACTTCATTTACCGACCAATACCTCGATTAACGCGATATGAATTATTGCTCAGAGGAATTCTTGACGCTA
CTCCTCCTGGGCACGAAGATAGGAGCGCGATCCCTCAAGTCATAGAAACCCTCAAACTGTTAGGCAAAGATACAG
AACCCGGGGTTGCGTCAGCCAAGCAGAAGGTTGATTTATGGAAGTACAACGACTTAATCTTATTCAAACAAGGGG
AACATTTCGTGAGTAAAAATGTGTTCACAGTTGATCAAGGGAGCTCATAGCGTCGCGCGATAGGATATGGATCTA
CTAAACGATTCGCGGTCGCTTATACATTCTGGTAAATTATACCGTCAGGCTGAAGGAGGTGTTGCCATCGGTCGG
GGCGATTTGGCAGAATTATTTGTCATCCTTTTTGACAACTACCGTACGTCTCCCTCCGTCTATACTTTGCGACTT
GTCGTTGATTTCCTCCAGTTCTGATGACGAAGGCCAAACCAAAAGAAGAGACGATGGAATACCATGTTACCCGAC
GAGTAAGTGTGCTGATTGTCGCGATTTATGAATGTAACCCGTGTTTCAGCCAATTCCTCTCGACCTACTGTTGTT
GGTCAAATTTGACGAACCACCAGTTCAGCGTCCAACTGGCCTCTTACGTACCCGCCGTGGCGATCGAAGTGCTAC
CAGTCCGACGGGGTCACATCCCAATCGAAGTGACAGTGTAGATTCTAATTTATTATATCCCTTTGTTCTCCACCA
TACGGGCCGATTGGGTGGACAGTGCGTTTTGTACGCTGAATCAGCATCGGTGCGAACTGAATGGCAGAAGAAATT
AGAGGAAACTTTGGGATTGCGGACAGTAGTCATGGAATCGAACAAAATGTTCGAAATGGAGACATTGAGCCAAGA
GACATTCTTGCTGCCAGCCTTCCCGGGTACTCAAGTTGTACCAACGTGGAGTGATACAACAACCTTGGGTGGTAA
AGTAACTTGTTCAGTGCCATTCAGTACGTTCAATCTCCTTTCTGCTTTTCCGCTCTAAACTTTTCTATCAGCCAC
GCGGGATAATCGTAAACTTGTGGCTATGGCTTGTGCCGAAGGTGTCTGGATGGGCTTTCTTCATGATCCCCGGTG
TAAGTGCACTTTTTTGTAATCATTTTATTCATCGCTGTTGACAATGGCCTCAATAGCTATGCGTCGCGTGCTTCA
TCTGCGAAATGTGACTCAGTGTGCCATGCTCGAGGATTTTGGGCTTTTCCTGGTCCTCGCTGACAAAACCCTGTT
TGCTTATCATATCGAAGCTTTAGTGCCCACTCAGCCATATGGTCCACTTGTGCCAGTTGACTATCAGCGGGTGAA
TTCTGCAGGGAAAGATGTCCAGTTCTTTTCGGTTGGGACCATGAACAACCGAACACTGGTAGTTTACATGAGGAA
GTCGAGAGGGGTGAGTTCCACTGACTTTTAATAAAAGAGTGAAAGTATTCATCTGCTGCACACCAGTCGGAAAGC
TTTTTTCACGCTTTGGAGCCTGTCGCCGACAAGATTGGGGAACGCCCAAAGACAAGCTCGGGTATTACCTCGATC
TTCAAAAACAAGTCTAGCTGGTTCCGAACGTATAAAGAATTCACTCTACCCGGAGAATGCTACGATTTCATTTTC
CTCAAAACGAGGATTGCAATACCTTGTCAGAAGGGTTTCGAAATCATGCAGATTGAAACGTAGGTTTCATCTGCC
CGCAATAATGGACGATTCAAGTTGATGATTTTTTTTTCAAAGTATGATCAGCGTCACGATACCTGTAATACAAGA
CTCCCGACTTACTACGCGTTGTGGATCTGCTCGGCCGCTAGGTATGTTCCGAGTCAATGATGATGAGTTTATCCT
TTGTTATGACGGTATGTACCTTTGCAACATTCCATCGGATAACATTTCACCTTCGGGGTACCTAGAATTTGGACT
GTTTGTCAATAGAAAAGGGGATCCTTCGCGAAAGAACTCAACAGTTGAATGGGAAGGCACTGCCGATCACGTCGC
CCTCCATGCTCCTTACATTCTCCTCTTCGATTCTCGTTTCATCGAAGTTAGGCATGTCGATACTGGCCGCCTAGC
TCAAATTATACCCGGGACTGATGTTCGATGTGTATGGGATGGGCGTGGCACTGATCAATCTCCAGCGTTGATGAT
GGCTCCAGGACCCCACGAGAATATGTCTCAAGAACCTAAAGTTCACGCCGTTATGAGTGTGAGCACGGATCAACA
ATACCCATCTAGCGGAAGAAGTCATCGAGGGGTGTACCAACACGTCTTTGAACTTGTTCCAACTATACCCTTGTA
TCTACCTGACCCAATTGCGTCACCTCCTGCGGCAACACAATTCCTTCATCCTTCGTATTCGCCGCCGAGATCCCC
GCTTTCACGACCTGGAGGAAGTTTAAGTTATCGCTCGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail