Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090940
Gene name
Locationscaffold_6:708073..709959
Strand-
Gene length (bp)1886
Transcript length (bp)1356
Coding sequence length (bp)1356
Protein length (aa) 452

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 6.8E-13 112 272
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-10 118 224
PF08242 Methyltransf_12 Methyltransferase domain 6.2E-10 120 226
PF08241 Methyltransf_11 Methyltransferase domain 3.8E-08 120 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 15 282 3.0E-80
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 2 272 5.0E-79
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 16 275 5.0E-60
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 20 296 3.0E-59
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 23 273 9.0E-55
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q08641|AB140_YEAST tRNA(Thr) (cytosine(32)-N(3))-methyltransferase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ABP140 PE=1 SV=3 15 282 3.0E-80
sp|Q9P7L6|METL_SCHPO Uncharacterized methyltransferase-like protein SPBC21C3.07c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC21C3.07c PE=3 SV=2 2 272 5.0E-79
sp|A8KBL7|MEL2A_DANRE Methyltransferase-like protein 2-A OS=Danio rerio GN=mettl2a PE=2 SV=1 16 275 5.0E-60
sp|Q5M8E6|METL2_XENTR Methyltransferase-like protein 2 OS=Xenopus tropicalis GN=mettl2 PE=2 SV=1 20 296 3.0E-59
sp|Q86BS6|METL_DROME Methyltransferase-like protein OS=Drosophila melanogaster GN=metl PE=1 SV=2 23 273 9.0E-55
sp|Q8BMK1|METL2_MOUSE Methyltransferase-like protein 2 OS=Mus musculus GN=Mettl2 PE=2 SV=2 20 275 2.0E-52
sp|Q8TCB7|METL6_HUMAN Methyltransferase-like protein 6 OS=Homo sapiens GN=METTL6 PE=2 SV=2 58 275 2.0E-52
sp|Q5RDV8|METL6_PONAB Methyltransferase-like protein 6 OS=Pongo abelii GN=METTL6 PE=2 SV=1 58 275 2.0E-49
sp|Q8BVH9|METL6_MOUSE Methyltransferase-like protein 6 OS=Mus musculus GN=Mettl6 PE=2 SV=2 64 275 3.0E-46
sp|Q6AXU8|METL6_RAT Methyltransferase-like protein 6 OS=Rattus norvegicus GN=Mettl6 PE=2 SV=1 64 275 7.0E-46
sp|Q6P1Q9|MET2B_HUMAN Methyltransferase-like protein 2B OS=Homo sapiens GN=METTL2B PE=1 SV=3 118 273 9.0E-43
sp|Q96IZ6|MET2A_HUMAN Methyltransferase-like protein 2A OS=Homo sapiens GN=METTL2A PE=1 SV=5 118 273 2.0E-42
sp|Q5ZHP8|METL2_CHICK Methyltransferase-like protein 2 OS=Gallus gallus GN=METTL2 PE=2 SV=1 118 296 5.0E-42
sp|Q0P5B2|METL2_BOVIN Methyltransferase-like protein 2 OS=Bos taurus GN=METTL2 PE=2 SV=1 118 273 2.0E-41
sp|Q8T199|OMT3_DICDI O-methyltransferase 3 OS=Dictyostelium discoideum GN=omt3 PE=2 SV=1 109 281 1.0E-34
sp|O74386|YNVB_SCHPO Uncharacterized methyltransferase C3H7.11 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPBC3H7.11 PE=3 SV=1 80 269 1.0E-25
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 118 207 1.0E-14
sp|Q9H825|METL8_HUMAN Methyltransferase-like protein 8 OS=Homo sapiens GN=METTL8 PE=2 SV=2 7 106 1.0E-12
sp|A2AUU0|METL8_MOUSE Methyltransferase-like protein 8 OS=Mus musculus GN=Mettl8 PE=1 SV=2 7 106 2.0E-12
sp|Q0P5B2|METL2_BOVIN Methyltransferase-like protein 2 OS=Bos taurus GN=METTL2 PE=2 SV=1 22 105 6.0E-10
sp|Q6P1Q9|MET2B_HUMAN Methyltransferase-like protein 2B OS=Homo sapiens GN=METTL2B PE=1 SV=3 15 105 2.0E-09
sp|Q96IZ6|MET2A_HUMAN Methyltransferase-like protein 2A OS=Homo sapiens GN=METTL2A PE=1 SV=5 15 105 4.0E-09
sp|A2AUU0|METL8_MOUSE Methyltransferase-like protein 8 OS=Mus musculus GN=Mettl8 PE=1 SV=2 118 207 2.0E-07
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 51 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090940
MDNANPKITSSVHDIAKEMPPFGSRLLTNEADVWSQNAWDHVPPPDDQGEIIAASLDRQRSTAVPLHEQPKYNEK
PARHWDNFYKANADNFFRNRKWLHNEFYELIAATECDAGPMVIAEVGCGAGNSVFPLLSANKNPQLVFKAYDYSN
HAIKLVQSNPLYASPPCGSINASVWDVTSINGLPADVPPGSVDIVVLVFVLSALHPDEWGKAVNNIYTMLKPGGR
VVMRDYGRYDLTQLRFKANRMLDENFYIRGDKTRVYFFELDELALMFTGSRALASQVTNTLSTDIAEDDGESSLN
FSSPEPRLGQDIESPSINNTVNNDRLDSQTSITELSTINSSAKAQMPNVWVHPKLLSPFSGCHPHPLFTIEQLGI
DRRLLENSAKSNKMFQACRSRLFYTVIHFEQPRELPKGRMPRSGGDLCTNRCRAAALSTRRVPLQIIHRLCCRAS
I*
Coding >AgabiH97|090940
ATGGATAACGCAAATCCGAAAATCACCTCTTCCGTCCACGACATAGCCAAAGAAATGCCTCCTTTTGGATCGAGA
CTCCTCACAAATGAAGCGGATGTTTGGTCCCAAAACGCTTGGGATCATGTCCCGCCTCCTGATGATCAAGGGGAA
ATCATCGCTGCTTCGTTAGATAGACAACGATCGACCGCCGTACCTCTTCACGAGCAGCCTAAATACAACGAAAAA
CCTGCGAGGCACTGGGATAATTTCTACAAAGCCAATGCTGATAATTTTTTTCGCAATCGCAAATGGCTTCACAAT
GAATTTTACGAGCTCATCGCTGCAACGGAGTGTGATGCTGGACCAATGGTGATAGCAGAGGTTGGTTGTGGGGCA
GGAAACTCTGTCTTTCCGCTGCTATCCGCGAACAAGAATCCTCAGCTGGTGTTCAAAGCCTATGACTACTCAAAC
CATGCTATCAAGCTCGTCCAGTCTAATCCCCTGTATGCATCGCCGCCTTGCGGCTCAATAAATGCATCAGTCTGG
GATGTCACATCTATTAATGGCTTACCTGCTGACGTGCCACCCGGAAGCGTCGATATCGTGGTTCTCGTATTCGTA
CTGAGCGCGCTACACCCGGATGAGTGGGGAAAAGCTGTCAACAACATCTATACAATGCTCAAACCAGGTGGCCGT
GTTGTGATGCGCGACTATGGCCGTTACGATCTGACACAGTTACGCTTCAAAGCCAATCGCATGCTAGACGAGAAT
TTCTATATCAGAGGGGATAAAACCCGTGTCTATTTCTTCGAACTAGACGAACTAGCACTAATGTTTACTGGTTCT
CGAGCACTAGCTTCTCAAGTCACAAACACTCTTAGCACGGACATTGCCGAAGACGATGGAGAATCATCGTTGAAT
TTCAGCTCTCCAGAACCAAGATTAGGACAAGACATAGAATCTCCTTCTATTAATAACACCGTCAATAATGACCGT
CTTGATTCACAGACATCGATAACCGAACTATCGACGATTAATTCCTCGGCGAAAGCACAAATGCCGAACGTATGG
GTGCACCCAAAACTTCTTTCACCCTTCTCAGGCTGCCATCCTCATCCTCTGTTTACGATCGAGCAGCTCGGTATA
GATCGCAGACTATTAGAAAATTCCGCAAAATCGAATAAAATGTTTCAGGCTTGCCGTAGCCGTCTGTTTTACACT
GTGATACATTTTGAGCAGCCACGCGAACTTCCGAAGGGCCGAATGCCACGATCAGGAGGCGACCTGTGCACCAAT
CGCTGTCGGGCTGCGGCGCTGTCAACGCGACGAGTCCCACTACAAATTATTCATAGACTCTGTTGTAGAGCTTCC
ATATGA
Transcript >AgabiH97|090940
ATGGATAACGCAAATCCGAAAATCACCTCTTCCGTCCACGACATAGCCAAAGAAATGCCTCCTTTTGGATCGAGA
CTCCTCACAAATGAAGCGGATGTTTGGTCCCAAAACGCTTGGGATCATGTCCCGCCTCCTGATGATCAAGGGGAA
ATCATCGCTGCTTCGTTAGATAGACAACGATCGACCGCCGTACCTCTTCACGAGCAGCCTAAATACAACGAAAAA
CCTGCGAGGCACTGGGATAATTTCTACAAAGCCAATGCTGATAATTTTTTTCGCAATCGCAAATGGCTTCACAAT
GAATTTTACGAGCTCATCGCTGCAACGGAGTGTGATGCTGGACCAATGGTGATAGCAGAGGTTGGTTGTGGGGCA
GGAAACTCTGTCTTTCCGCTGCTATCCGCGAACAAGAATCCTCAGCTGGTGTTCAAAGCCTATGACTACTCAAAC
CATGCTATCAAGCTCGTCCAGTCTAATCCCCTGTATGCATCGCCGCCTTGCGGCTCAATAAATGCATCAGTCTGG
GATGTCACATCTATTAATGGCTTACCTGCTGACGTGCCACCCGGAAGCGTCGATATCGTGGTTCTCGTATTCGTA
CTGAGCGCGCTACACCCGGATGAGTGGGGAAAAGCTGTCAACAACATCTATACAATGCTCAAACCAGGTGGCCGT
GTTGTGATGCGCGACTATGGCCGTTACGATCTGACACAGTTACGCTTCAAAGCCAATCGCATGCTAGACGAGAAT
TTCTATATCAGAGGGGATAAAACCCGTGTCTATTTCTTCGAACTAGACGAACTAGCACTAATGTTTACTGGTTCT
CGAGCACTAGCTTCTCAAGTCACAAACACTCTTAGCACGGACATTGCCGAAGACGATGGAGAATCATCGTTGAAT
TTCAGCTCTCCAGAACCAAGATTAGGACAAGACATAGAATCTCCTTCTATTAATAACACCGTCAATAATGACCGT
CTTGATTCACAGACATCGATAACCGAACTATCGACGATTAATTCCTCGGCGAAAGCACAAATGCCGAACGTATGG
GTGCACCCAAAACTTCTTTCACCCTTCTCAGGCTGCCATCCTCATCCTCTGTTTACGATCGAGCAGCTCGGTATA
GATCGCAGACTATTAGAAAATTCCGCAAAATCGAATAAAATGTTTCAGGCTTGCCGTAGCCGTCTGTTTTACACT
GTGATACATTTTGAGCAGCCACGCGAACTTCCGAAGGGCCGAATGCCACGATCAGGAGGCGACCTGTGCACCAAT
CGCTGTCGGGCTGCGGCGCTGTCAACGCGACGAGTCCCACTACAAATTATTCATAGACTCTGTTGTAGAGCTTCC
ATATGA
Gene >AgabiH97|090940
ATGGATAACGCAAATCCGAAAATCACCTCTTCCGTCCACGACATAGCCAAAGAAATGCCTCCTTTTGGATCGAGG
TCAGCATCGCGCTGTACTTCAGCCGGTACGAATAATGATTCAGCCATAGACTCCTCACAAATGAAGCGGATGTTT
GGTCCCAAAACGCTTGGGATCATGTCCCGCCTCCTGATGATCAAGGGGAAATCATCGCTGCTTCGTTAGATAGAC
AACGATCGACCGCCGTACCTCTTCACGAGCAGCCTAAATACAACGAAAAACCTGCGAGGCACTGGTCCGACTTTC
ATATTCTATCCTCGAGTAGATGCGAAACTGATTCCATTTTAGGGATAATTTCTACAAAGCCAATGCTGATAATTT
TTTTCGCAATCGCAAATGGTAAGAAACCACCAAGAGCATACAATCCGGGAACCGACTTCTTATCCCAGGCTTCAC
AATGAATTTTACGAGCTCATCGCTGCAACGGAGTGTGATGTATGAAAACTCATTCGGCAAATCACGATCCAGAAA
AGTCATTATCTTATTTTGACTAGGCTGGACCAATGGTGATAGCAGAGGTTGGTTGTGGTGAGTTGTGGTCTTACC
CTACCGACTTCTGGTCTGTTTGACTTGAAGAGCAAGGGGCAGGAAACTCTGTCTTTCCGCTGCTATCCGCGAACA
AGAATCCTCAGCTGGTGTTCAAAGCCTATGACTACTCAAACCATGCTATCAAGCTCGTCCAGGTGAAAATTTGAA
GCACTATATCTGTAGTCTTCTCTCTCACCGGCTTTCAGTCTAATCCCCTGTATGCATCGCCGCCTTGCGGCTCAA
TAAATGCATCAGTCTGGGATGTCACATCTATTAATGGCTTACCTGCTGACGTGCCACCCGGAAGCGTCGATATCG
TGGTTCTCGTATTCGTACTGAGCGCGCTACACCCGGATGAGTGGGGAAAAGCTGTCAACAACATCTATACAGTGA
GAGATCAAATGACGGTCGCTTTGTTGGTCGGCGATATGAGAAGCTTACTATTAAGCAGATGCTCAAACCAGGTGG
CCGTGTTGTGATGCGCGACTATGGCCGTTACGATCTGACACAGTTACGCTTCAAAGCCAATCGCATGCTAGACGA
GAATTTCTATATCAGAGGGGATAAAACCCGTGTCTATTTCTTCGAACTAGGTCTCTTCTCGCTATTCACAGATAA
AGTGGAGACTAACATGATTCTAGACGAACTAGCACTAATGTTTACTGGTTCTCGAGCACTAGCTTCTCAAGTCAC
AAACACTCTTAGCACGGACATTGCCGAAGACGATGGAGAATCATCGTTGAATTTCAGCTCTCCAGAACCAAGATT
AGGACAAGACATAGAATCTCCTTCTATTAATAACACCGTCAATAATGACCGTCTTGATTCACAGACATCGATAAC
CGAACTATCGACGATTAATTCCTCGGCGAAAGCACAAATGCCGAACGTATGGGTGCACCCAAAACTTCTTTCACC
CTTCTCAGGCTGCCATCCTCATCCTCTGTTTACGATCGAGCAGCTCGGTATAGATCGCAGACTATTAGTGAACCG
CAAGCGTCAGCTTAAAATGTATCGTGTTTGGATGCAAGGAAAATTCCGCAAAATCGAATAAAATGTTTCAGGCTT
GCCGTAGCCGTCTGTTTTACACTGTGGTTTGTGTCTTATCATTGCTAGAGCTTAACATTGATTTGTCTATACATT
GACTGGAGATACATTTTGAGCAGCCACGCGAACTTCCGAAGGGCCGAATGCCACGATCAGGAGGCGACCTGTGCA
CCAATCGCTGTCGGGCTGCGGCGCTGTCAACGCGACGAGTCCCACTACAAATTATTCATAGACTCTGTTGTAGAG
CTTCCATATGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail