Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090910
Gene name
Locationscaffold_6:699427..702453
Strand-
Gene length (bp)3026
Transcript length (bp)2661
Coding sequence length (bp)2661
Protein length (aa) 887

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF07713 DUF1604 Protein of unknown function (DUF1604) 5.3E-39 45 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K12|GPTC1_BOVIN G patch domain-containing protein 1 OS=Bos taurus GN=GPATCH1 PE=2 SV=1 19 612 1.0E-70
sp|Q9BRR8|GPTC1_HUMAN G patch domain-containing protein 1 OS=Homo sapiens GN=GPATCH1 PE=1 SV=1 19 612 7.0E-68
sp|Q9DBM1|GPTC1_MOUSE G patch domain-containing protein 1 OS=Mus musculus GN=Gpatch1 PE=2 SV=1 19 612 1.0E-61
sp|Q9VUA0|GPTC1_DROME G patch domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG8833 PE=2 SV=1 23 612 1.0E-41
sp|Q8GXN9|TGH_ARATH G patch domain-containing protein TGH OS=Arabidopsis thaliana GN=TGH PE=2 SV=1 45 291 1.0E-38
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q24K12|GPTC1_BOVIN G patch domain-containing protein 1 OS=Bos taurus GN=GPATCH1 PE=2 SV=1 19 612 1.0E-70
sp|Q9BRR8|GPTC1_HUMAN G patch domain-containing protein 1 OS=Homo sapiens GN=GPATCH1 PE=1 SV=1 19 612 7.0E-68
sp|Q9DBM1|GPTC1_MOUSE G patch domain-containing protein 1 OS=Mus musculus GN=Gpatch1 PE=2 SV=1 19 612 1.0E-61
sp|Q9VUA0|GPTC1_DROME G patch domain-containing protein 1 homolog OS=Drosophila melanogaster GN=CG8833 PE=2 SV=1 23 612 1.0E-41
sp|Q8GXN9|TGH_ARATH G patch domain-containing protein TGH OS=Arabidopsis thaliana GN=TGH PE=2 SV=1 45 291 1.0E-38
sp|Q67VW6|TGHH_ORYSJ G patch domain-containing protein TGH homolog OS=Oryza sativa subsp. japonica GN=Os06g0489200 PE=2 SV=1 23 291 3.0E-37
sp|B8B2G4|TGHH_ORYSI G patch domain-containing protein TGH homolog OS=Oryza sativa subsp. indica GN=OsI_23032 PE=3 SV=1 23 291 3.0E-37
sp|Q21827|GPTC1_CAEEL G patch domain-containing protein 1 homolog OS=Caenorhabditis elegans GN=R07E5.1 PE=1 SV=1 54 622 2.0E-33
sp|Q9HE07|YK96_SCHPO Uncharacterized protein C20H4.06c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC20H4.06c PE=4 SV=1 25 368 2.0E-30
[Show less]

GO

GO Term Description Terminal node
GO:0006397 mRNA processing Yes
GO:0044237 cellular metabolic process No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0071704 organic substance metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0008150 biological_process No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0016071 mRNA metabolic process No
GO:0006807 nitrogen compound metabolic process No
GO:0016070 RNA metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0008152 metabolic process No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090910
MSTRLKRKLNDLGVDVTSSRASESFCLIGTPLPPLEKSKDTGEFVPLWKQEVLDEKGRRRLHGAFTGGFSAGYFN
TVGSKEGWTPATFVSSRADRTKAKASRPEDYMDEEDLQELRESRTLVDTVEEMDISGGTAAELKRRRNEDDTEQD
SIVNALQSTLLPPAADSAGARILRKMGWRVGSGVGPRVSLKQRRLQDLQTSSPYGTRAVIDDIKLTEDDEEASKH
TYAPRDTPVLIIERKDNFHGLGYRSGMTLNESLGSSKADSGKGPRISAGFGLGALNDADEDDLDVYDADIRKVRN
RLAYDAKHDDTLVLGNKGNSSRPQMRSTVGSTVFHDGSKVLSGFTLSEKPVVEERWFKMPDMPAGWQPDPRRVWE
VNKENIPKREVIREPMAYSKWKSSGMTAGERGEMLGETPIQTGPRSVFDYLSEKDRERLKNITAATSAGVSPSAL
QSFSAPRTEAHVAQAALKGFQPFSSDPAKHDRYTTYLHSQANPDGTSPPLEPLPDQRPDDFQKELEDYSKAAIIF
KPVSGAMGGRFQSAAHVEKGPVVREGLHQPTMEELEDLEAKRRKEEEEKLSPQAHAAKLGMYGAMTREVKVWLPA
RLLSKRFGVKEPDIPLDDLAGAATEKGPSFTTSEAEKSFREAAGLDSKTGSVDPNQAQSGSSGDGRNLANVGLGE
DESQGRDTLTYERPAMDVFKAIFASDDEESDDEKEEEDIPEPEVAASSKEVANGSSGPSHSLLDDKPVDMTTFRP
TFIPRENKAKKSKDDDEGKEKKGKKHKKDKKKKDKGPLVSFDVDEDGVEGLSLKVTSEERSKKRRKKDKKKREDD
EDGSMWVEKPAPEITKNLPPLSTVNAAVDTQDTEVTVSGGLSPNGQDTGARRARKRAIDFL*
Coding >AgabiH97|090910
ATGAGCACCCGTTTGAAACGCAAGCTCAATGACCTGGGTGTCGATGTCACAAGTTCAAGGGCGAGTGAATCCTTC
TGTTTGATAGGTACTCCCCTCCCTCCATTAGAAAAATCAAAAGACACAGGAGAATTTGTACCTCTTTGGAAGCAA
GAGGTACTTGATGAGAAAGGCAGGCGACGTTTGCATGGTGCATTCACTGGCGGTTTCTCTGCTGGATATTTTAAC
ACCGTAGGGTCGAAGGAGGGATGGACACCTGCAACATTTGTATCTTCACGTGCGGATAGGACAAAAGCAAAGGCT
TCGCGACCAGAGGATTATATGGACGAGGAAGACTTGCAAGAGCTTCGTGAAAGCAGGACGTTGGTTGATACTGTT
GAGGAAATGGACATTTCTGGAGGGACGGCTGCTGAGCTTAAGCGACGGAGAAATGAAGATGACACAGAACAAGAT
TCCATCGTCAATGCTTTGCAATCTACTTTGTTACCTCCTGCAGCAGATTCAGCTGGTGCCCGGATTCTCAGGAAG
ATGGGCTGGCGAGTCGGTAGTGGTGTTGGACCTCGCGTATCTCTCAAGCAACGCAGACTACAAGATCTACAGACA
TCCTCCCCTTACGGGACCAGGGCTGTTATCGACGATATTAAGCTCACAGAAGACGACGAGGAGGCCAGCAAACAT
ACTTATGCTCCCAGAGACACCCCCGTTTTGATTATAGAGAGAAAAGACAACTTCCACGGTCTAGGGTACCGATCT
GGAATGACACTTAATGAAAGCCTGGGGTCCTCGAAGGCGGACAGTGGAAAGGGCCCTCGAATATCAGCTGGATTT
GGCCTTGGCGCGTTAAATGATGCTGATGAGGATGACCTCGACGTGTACGATGCTGATATCAGGAAAGTGCGGAAT
CGTTTGGCTTATGACGCCAAACACGACGATACGCTTGTGCTCGGCAATAAAGGAAATTCTTCTAGGCCTCAAATG
AGGTCTACAGTAGGTTCTACTGTCTTCCATGACGGGTCCAAGGTCCTCAGTGGATTTACTCTTTCTGAGAAGCCT
GTGGTCGAGGAAAGATGGTTCAAAATGCCTGATATGCCAGCTGGATGGCAACCAGATCCTCGACGAGTCTGGGAG
GTTAATAAAGAAAACATTCCTAAGCGCGAGGTTATTCGAGAACCAATGGCCTACAGCAAGTGGAAATCCTCCGGT
ATGACAGCTGGGGAGCGCGGAGAAATGCTCGGGGAGACGCCAATCCAAACGGGCCCTCGTTCTGTGTTTGACTAT
TTGTCCGAAAAGGATCGTGAACGCTTGAAGAACATCACCGCGGCGACTTCTGCAGGTGTATCTCCATCTGCTTTG
CAAAGTTTCTCCGCTCCTCGGACAGAGGCACATGTAGCACAAGCTGCGCTCAAAGGGTTCCAACCATTCAGTTCT
GATCCAGCTAAACACGACAGGTATACGACCTATCTCCACTCGCAAGCTAACCCTGATGGAACAAGTCCTCCATTG
GAACCATTGCCTGATCAACGGCCTGACGATTTTCAGAAGGAACTCGAGGATTATTCCAAAGCTGCCATAATTTTC
AAACCAGTCTCTGGTGCTATGGGTGGCCGATTTCAGTCAGCCGCGCATGTTGAAAAAGGGCCCGTCGTCCGTGAA
GGACTTCATCAGCCTACGATGGAGGAGCTGGAGGACTTGGAAGCGAAAAGGAGGAAGGAGGAAGAAGAGAAGCTC
AGTCCACAAGCTCACGCCGCAAAGCTAGGCATGTATGGAGCCATGACCAGAGAAGTCAAAGTCTGGCTACCGGCT
CGGCTTTTGTCCAAGAGGTTTGGGGTAAAGGAACCAGATATACCTCTGGATGACTTGGCCGGCGCGGCTACGGAA
AAGGGCCCGTCGTTTACTACTTCGGAAGCAGAAAAATCTTTTCGTGAAGCAGCTGGCCTCGATTCCAAGACTGGT
TCTGTGGATCCCAACCAAGCACAGTCAGGTTCGAGTGGTGATGGTCGAAATTTGGCCAATGTTGGACTAGGGGAA
GACGAGTCCCAGGGCCGAGATACGCTGACGTATGAAAGACCCGCGATGGATGTTTTCAAGGCTATATTTGCGAGT
GACGATGAAGAAAGTGACGATGAGAAGGAGGAGGAGGACATCCCTGAACCCGAAGTTGCTGCCAGTAGCAAGGAA
GTAGCGAATGGATCGTCTGGACCTTCGCATTCTCTCCTCGACGATAAGCCTGTAGATATGACCACTTTTCGACCA
ACGTTCATACCCAGGGAAAATAAAGCCAAGAAGTCGAAGGATGACGACGAGGGAAAAGAAAAGAAGGGAAAGAAG
CACAAGAAAGATAAAAAGAAGAAAGACAAAGGGCCATTGGTATCGTTCGATGTCGACGAAGATGGTGTTGAGGGA
CTTTCGCTCAAAGTGACCTCTGAAGAGCGTTCGAAGAAGAGAAGAAAAAAGGACAAGAAAAAACGCGAAGATGAC
GAAGATGGGAGTATGTGGGTGGAGAAACCCGCCCCAGAAATAACCAAAAATCTGCCGCCACTCTCCACTGTCAAT
GCGGCGGTCGACACGCAGGATACGGAAGTGACGGTATCTGGTGGTTTGAGCCCTAATGGCCAAGATACAGGTGCT
CGTAGAGCGCGTAAACGTGCAATTGACTTTTTATAG
Transcript >AgabiH97|090910
ATGAGCACCCGTTTGAAACGCAAGCTCAATGACCTGGGTGTCGATGTCACAAGTTCAAGGGCGAGTGAATCCTTC
TGTTTGATAGGTACTCCCCTCCCTCCATTAGAAAAATCAAAAGACACAGGAGAATTTGTACCTCTTTGGAAGCAA
GAGGTACTTGATGAGAAAGGCAGGCGACGTTTGCATGGTGCATTCACTGGCGGTTTCTCTGCTGGATATTTTAAC
ACCGTAGGGTCGAAGGAGGGATGGACACCTGCAACATTTGTATCTTCACGTGCGGATAGGACAAAAGCAAAGGCT
TCGCGACCAGAGGATTATATGGACGAGGAAGACTTGCAAGAGCTTCGTGAAAGCAGGACGTTGGTTGATACTGTT
GAGGAAATGGACATTTCTGGAGGGACGGCTGCTGAGCTTAAGCGACGGAGAAATGAAGATGACACAGAACAAGAT
TCCATCGTCAATGCTTTGCAATCTACTTTGTTACCTCCTGCAGCAGATTCAGCTGGTGCCCGGATTCTCAGGAAG
ATGGGCTGGCGAGTCGGTAGTGGTGTTGGACCTCGCGTATCTCTCAAGCAACGCAGACTACAAGATCTACAGACA
TCCTCCCCTTACGGGACCAGGGCTGTTATCGACGATATTAAGCTCACAGAAGACGACGAGGAGGCCAGCAAACAT
ACTTATGCTCCCAGAGACACCCCCGTTTTGATTATAGAGAGAAAAGACAACTTCCACGGTCTAGGGTACCGATCT
GGAATGACACTTAATGAAAGCCTGGGGTCCTCGAAGGCGGACAGTGGAAAGGGCCCTCGAATATCAGCTGGATTT
GGCCTTGGCGCGTTAAATGATGCTGATGAGGATGACCTCGACGTGTACGATGCTGATATCAGGAAAGTGCGGAAT
CGTTTGGCTTATGACGCCAAACACGACGATACGCTTGTGCTCGGCAATAAAGGAAATTCTTCTAGGCCTCAAATG
AGGTCTACAGTAGGTTCTACTGTCTTCCATGACGGGTCCAAGGTCCTCAGTGGATTTACTCTTTCTGAGAAGCCT
GTGGTCGAGGAAAGATGGTTCAAAATGCCTGATATGCCAGCTGGATGGCAACCAGATCCTCGACGAGTCTGGGAG
GTTAATAAAGAAAACATTCCTAAGCGCGAGGTTATTCGAGAACCAATGGCCTACAGCAAGTGGAAATCCTCCGGT
ATGACAGCTGGGGAGCGCGGAGAAATGCTCGGGGAGACGCCAATCCAAACGGGCCCTCGTTCTGTGTTTGACTAT
TTGTCCGAAAAGGATCGTGAACGCTTGAAGAACATCACCGCGGCGACTTCTGCAGGTGTATCTCCATCTGCTTTG
CAAAGTTTCTCCGCTCCTCGGACAGAGGCACATGTAGCACAAGCTGCGCTCAAAGGGTTCCAACCATTCAGTTCT
GATCCAGCTAAACACGACAGGTATACGACCTATCTCCACTCGCAAGCTAACCCTGATGGAACAAGTCCTCCATTG
GAACCATTGCCTGATCAACGGCCTGACGATTTTCAGAAGGAACTCGAGGATTATTCCAAAGCTGCCATAATTTTC
AAACCAGTCTCTGGTGCTATGGGTGGCCGATTTCAGTCAGCCGCGCATGTTGAAAAAGGGCCCGTCGTCCGTGAA
GGACTTCATCAGCCTACGATGGAGGAGCTGGAGGACTTGGAAGCGAAAAGGAGGAAGGAGGAAGAAGAGAAGCTC
AGTCCACAAGCTCACGCCGCAAAGCTAGGCATGTATGGAGCCATGACCAGAGAAGTCAAAGTCTGGCTACCGGCT
CGGCTTTTGTCCAAGAGGTTTGGGGTAAAGGAACCAGATATACCTCTGGATGACTTGGCCGGCGCGGCTACGGAA
AAGGGCCCGTCGTTTACTACTTCGGAAGCAGAAAAATCTTTTCGTGAAGCAGCTGGCCTCGATTCCAAGACTGGT
TCTGTGGATCCCAACCAAGCACAGTCAGGTTCGAGTGGTGATGGTCGAAATTTGGCCAATGTTGGACTAGGGGAA
GACGAGTCCCAGGGCCGAGATACGCTGACGTATGAAAGACCCGCGATGGATGTTTTCAAGGCTATATTTGCGAGT
GACGATGAAGAAAGTGACGATGAGAAGGAGGAGGAGGACATCCCTGAACCCGAAGTTGCTGCCAGTAGCAAGGAA
GTAGCGAATGGATCGTCTGGACCTTCGCATTCTCTCCTCGACGATAAGCCTGTAGATATGACCACTTTTCGACCA
ACGTTCATACCCAGGGAAAATAAAGCCAAGAAGTCGAAGGATGACGACGAGGGAAAAGAAAAGAAGGGAAAGAAG
CACAAGAAAGATAAAAAGAAGAAAGACAAAGGGCCATTGGTATCGTTCGATGTCGACGAAGATGGTGTTGAGGGA
CTTTCGCTCAAAGTGACCTCTGAAGAGCGTTCGAAGAAGAGAAGAAAAAAGGACAAGAAAAAACGCGAAGATGAC
GAAGATGGGAGTATGTGGGTGGAGAAACCCGCCCCAGAAATAACCAAAAATCTGCCGCCACTCTCCACTGTCAAT
GCGGCGGTCGACACGCAGGATACGGAAGTGACGGTATCTGGTGGTTTGAGCCCTAATGGCCAAGATACAGGTGCT
CGTAGAGCGCGTAAACGTGCAATTGACTTTTTATAG
Gene >AgabiH97|090910
ATGAGCACCCGTTTGAAACGCAAGCTCAATGACCTGGGTGTCGATGTCACAAGTTCAAGGGCGAGTGAATCCTTC
TGTTTGGTGCGATTTTGTCTGCCAAGTAATAATTGTGAAGCTGATGGCAATGAAGATAGGTACTCCCCTCCCTCC
ATTAGAAAAATCAAAAGACACAGGAGAATTTGTACCTCTTTGGAAGCAAGAGGCAAGTTTCGTTCAATGGTAGTA
TCGTTTGTGAACTGACCCGTATCCTCAGGTACTTGATGAGAAAGGCAGGCGACGTTTGCATGGTGCATTCACTGG
CGGTTTCTCTGCTGGATATTTTAACACCGTAGGGTCGAAGGAGGGTACGTAGTCTCTTTCAAAAAGTTTACGCAT
GCTCCTGAACTTGTTCGAGGATGGACACCTGCAACATTTGTATCTTCACGTGCGGATAGGACAAAAGCAAAGGCT
TCGCGACCAGAGGATTATATGGACGAGGAAGACTTGCAAGAGCTTCGTGAAAGCAGGACGTTGGTTGATACTGTT
GAGGAAATGGACATTTCTGGAGGGACGGCTGCTGAGCTTAAGCGACGGAGAAATGAAGATGACACAGAACAAGAG
TACGTCGCTTTAGTCGGGATCGCATTCTCTTACTCATTTGTCATTCATAAAATCAGTTCCATCGTCAATGCTTTG
CAATCTACTTTGTTACCTCCTGCAGCAGATTCAGCTGGTGCCCGGATTCTCAGGAAGATGGGCTGGCGAGTCGGT
AGTGGTGTTGGACCTCGCGTATCTCTCAAGCAACGCAGACTACAAGATCTACAGACATCCTCCCCTTACGGGACC
AGGGCTGTTATCGACGATATTAAGCTCACAGAAGACGACGAGGAGGCCAGCAAACATACTTATGCTCCCAGAGAC
ACCCCCGTTTTGATTATAGAGAGAAAAGACAACTTCCACGGTCTAGGGTACCGATCTGGAATGACACTTAATGAA
AGCCTGGGGTCCTCGAAGGCGGACAGTGGAAAGGGCCCTCGAATATCAGGCAAGTTCATCAGTAACGTTACCTCA
TCTTATTATTCATTCTTTTTGGTCAGCTGGATTTGGCCTTGGCGCGTTAAATGATGCTGATGAGGATGACCTCGA
CGTGTACGATGCTGATATCAGGAAAGTGCGGAATCGTTTGGCTTATGACGCCAAACACGACGATACGCTTGTGCT
CGGCAATAAAGGAAATTCTTCTAGGCCTCAAATGGTAAGTCATCGTTGTCTGAGCTTTGTAAACTTTTCCTTTCT
CCTTATATATTTAAGAGGTCTACAGTAGGTTCTACTGTCTTCCATGACGGGTCCAAGGTCCTCAGTGGATTTACT
CTTTCTGAGAAGCCTGTGGTCGAGGAAAGATGGTTCAAAATGCCTGATATGCCAGCTGGATGGCAACCAGATCCT
CGACGAGTCTGGGAGGTTAATAAAGAAAACATTCCTAAGCGCGAGGTTATTCGAGAACCAATGGCCTACAGCAAG
TGGAAATCCTCCGGTATGACAGCTGGGGAGGTACGAAACATTTTCACATTCATAGGAAACATTACTAATTTGCGT
GATAGCGCGGAGAAATGCTCGGGGAGACGCCAATCCAAACGGGCCCTCGTTCTGTGTTTGACTATTTGTCCGAAA
AGGATCGTGAACGCTTGAAGAACATCACCGCGGCGACTTCTGCAGGTGTATCTCCATCTGCTTTGCAAAGTTTCT
CCGCTCCTCGGACAGAGGCACATGTAGCACAAGCTGCGCTCAAAGGGTTCCAACCATTCAGTTCTGATCCAGCTA
AACACGACAGGTATACGACCTATCTCCACTCGCAAGCTAACCCTGATGGAACAAGTCCTCCATTGGAACCATTGC
CTGATCAACGGCCTGACGATTTTCAGAAGGAACTCGAGGATTATTCCAAAGCTGCCATAATTTTCAAACCAGTCT
CTGGTGCTATGGGTGGCCGATTTCAGTCAGCCGCGCATGTTGAAAAAGGGCCCGTCGTCCGTGAAGGACTTCATC
AGCCTACGATGGAGGAGCTGGAGGACTTGGAAGCGAAAAGGAGGAAGGAGGAAGAAGAGAAGCTCAGTCCACAAG
CTCACGCCGCAAAGCTAGGCATGTATGGAGCCATGACCAGAGAAGTCAAAGTCTGGCTACCGGCTCGGCTTTTGT
CCAAGAGGTTTGGGGTAAAGGAACCAGATATACCTCTGGATGACTTGGCCGGCGCGGCTACGGAAAAGGGCCCGT
CGTTTACTACTTCGGAAGCAGAAAAATCTTTTCGTGAAGCAGCTGGCCTCGATTCCAAGACTGGTTCTGTGGATC
CCAACCAAGCACAGTCAGGTTCGAGTGGTGATGGTCGAAATTTGGCCAATGTTGGACTAGGGGAAGACGAGTCCC
AGGGCCGAGATACGCTGACGTATGAAAGACCCGCGATGGATGTTTTCAAGGCTATATTTGCGAGTGACGATGAAG
AAAGTGACGATGAGAAGGAGGAGGAGGACATCCCTGAACCCGAAGTTGCTGCCAGTAGCAAGGAAGTAGCGAATG
GATCGTCTGGACCTTCGCATTCTCTCCTCGACGATAAGCCTGTAGATATGACCACTTTTCGACCAACGTTCATAC
CCAGGGAAAATAAAGCCAAGAAGTCGAAGGATGACGACGAGGGAAAAGAAAAGAAGGGAAAGAAGCACAAGAAAG
ATAAAAAGAAGAAAGACAAAGGGCCATTGGTATCGTTCGATGTCGACGAAGATGGTGTTGAGGGACTTTCGCTCA
AAGTGACCTCTGAAGAGCGTTCGAAGAAGAGAAGAAAAAAGGACAAGAAAAAACGCGAAGATGACGAAGATGGGA
GTATGTGGGTGGAGAAACCCGCCCCAGAAATAACCAAAAATCTGCCGCCACTCTCCACTGTCAATGCGGCGGTCG
ACACGCAGGATACGGAAGTGACGGTATCTGGTGGTTTGAGCCCTAATGGCCAAGATACAGGTGCTCGTAGAGCGC
GTAAACGTGCAATTGACTTTTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail