© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|090860 |
| Gene name | |
| Location | scaffold_6:684657..686121 |
| Strand | + |
| Gene length (bp) | 1464 |
| Transcript length (bp) | 1359 |
| Coding sequence length (bp) | 1359 |
| Protein length (aa) | 453 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 2.9E-06 | 21 | 80 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 1.1E-04 | 83 | 148 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 2.5E-05 | 153 | 201 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 7.6E-10 | 206 | 259 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 3.6E-08 | 263 | 320 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 2.3E-08 | 324 | 392 |
| PF00415 | RCC1 | Regulator of chromosome condensation (RCC1) repeat | 2.6E-07 | 397 | 445 |
| PF13540 | RCC1_2 | Regulator of chromosome condensation (RCC1) repeat | 9.7E-07 | 67 | 94 |
| PF13540 | RCC1_2 | Regulator of chromosome condensation (RCC1) repeat | 5.0E-10 | 247 | 275 |
| PF13540 | RCC1_2 | Regulator of chromosome condensation (RCC1) repeat | 7.0E-06 | 307 | 336 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P28745|RCC1_SCHPO | Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 | 2 | 445 | 7.0E-63 |
| sp|P21827|RCC1_YEAST | Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 | 13 | 445 | 7.0E-55 |
| sp|P25183|RCC1_XENLA | Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 | 7 | 451 | 3.0E-46 |
| sp|P18754|RCC1_HUMAN | Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 | 14 | 452 | 6.0E-43 |
| sp|P23800|RCC1_MESAU | Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 | 17 | 452 | 2.0E-42 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|P28745|RCC1_SCHPO | Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 | 2 | 445 | 7.0E-63 |
| sp|P21827|RCC1_YEAST | Guanine nucleotide exchange factor SRM1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=SRM1 PE=1 SV=1 | 13 | 445 | 7.0E-55 |
| sp|P25183|RCC1_XENLA | Regulator of chromosome condensation OS=Xenopus laevis GN=rcc1 PE=2 SV=1 | 7 | 451 | 3.0E-46 |
| sp|P18754|RCC1_HUMAN | Regulator of chromosome condensation OS=Homo sapiens GN=RCC1 PE=1 SV=1 | 14 | 452 | 6.0E-43 |
| sp|P23800|RCC1_MESAU | Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 | 17 | 452 | 2.0E-42 |
| sp|Q8VE37|RCC1_MOUSE | Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 | 17 | 451 | 7.0E-42 |
| sp|P25171|RCC1_DROME | Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 | 21 | 449 | 1.0E-39 |
| sp|P52499|RCC1_CANAX | Protein RCC1 OS=Candida albicans GN=RCC1 PE=3 SV=1 | 19 | 403 | 2.0E-38 |
| sp|Q9FN03|UVR8_ARATH | Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 | 20 | 424 | 4.0E-29 |
| sp|Q15034|HERC3_HUMAN | Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 | 21 | 424 | 1.0E-26 |
| sp|Q6PAV2|HERC4_MOUSE | Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 | 21 | 439 | 5.0E-26 |
| sp|Q5PQN1|HERC4_RAT | Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 | 21 | 439 | 1.0E-25 |
| sp|Q5GLZ8|HERC4_HUMAN | Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 | 21 | 439 | 5.0E-24 |
| sp|Q6PAV2|HERC4_MOUSE | Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 | 117 | 444 | 2.0E-21 |
| sp|Q18211|RCC1_CAEEL | Regulator of chromosome condensation OS=Caenorhabditis elegans GN=ran-3 PE=3 SV=1 | 60 | 450 | 2.0E-21 |
| sp|Q3MHW0|SRGEF_BOVIN | Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 | 5 | 449 | 2.0E-21 |
| sp|Q5PQN1|HERC4_RAT | Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 | 117 | 444 | 5.0E-21 |
| sp|Q9UGK8|SRGEF_HUMAN | Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 | 28 | 449 | 2.0E-20 |
| sp|Q8IVU3|HERC6_HUMAN | Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 | 174 | 446 | 3.0E-20 |
| sp|Q5GLZ8|HERC4_HUMAN | Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 | 117 | 444 | 8.0E-20 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 53 | 446 | 1.0E-19 |
| sp|Q80YD6|SRGEF_MOUSE | Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 | 14 | 449 | 3.0E-19 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 53 | 446 | 4.0E-19 |
| sp|Q15034|HERC3_HUMAN | Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 | 139 | 447 | 9.0E-19 |
| sp|F2Z461|HERC6_MOUSE | E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 | 61 | 337 | 1.0E-18 |
| sp|Q9N1T2|RPGR_CANLF | X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 | 21 | 339 | 4.0E-18 |
| sp|Q9FN03|UVR8_ARATH | Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 | 15 | 348 | 2.0E-17 |
| sp|F2Z461|HERC6_MOUSE | E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 | 156 | 446 | 2.0E-17 |
| sp|Q8NDN9|RCBT1_HUMAN | RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 | 135 | 444 | 4.0E-17 |
| sp|Q6NXM2|RCBT1_MOUSE | RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 | 135 | 444 | 4.0E-17 |
| sp|Q92834|RPGR_HUMAN | X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 | 21 | 339 | 1.0E-16 |
| sp|Q9FN03|UVR8_ARATH | Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 | 188 | 447 | 3.0E-16 |
| sp|Q9UII4|HERC5_HUMAN | E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 | 188 | 446 | 4.0E-16 |
| sp|Q6P798|RCBT2_RAT | RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 | 154 | 444 | 4.0E-16 |
| sp|Q99LJ7|RCBT2_MOUSE | RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 | 154 | 444 | 4.0E-16 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 21 | 429 | 5.0E-16 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 118 | 446 | 9.0E-16 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 118 | 446 | 1.0E-15 |
| sp|Q99LJ7|RCBT2_MOUSE | RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 | 123 | 404 | 1.0E-15 |
| sp|Q5RCZ7|RCBT2_PONAB | RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 | 123 | 404 | 1.0E-15 |
| sp|O95199|RCBT2_HUMAN | RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 | 123 | 404 | 1.0E-15 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 21 | 338 | 2.0E-15 |
| sp|Q9R0X5|RPGR_MOUSE | X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 | 21 | 339 | 2.0E-15 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 68 | 338 | 3.0E-15 |
| sp|Q52KW8|RCC2_XENLA | Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 | 183 | 424 | 3.0E-15 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 55 | 347 | 3.0E-15 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 69 | 338 | 4.0E-15 |
| sp|Q6P798|RCBT2_RAT | RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 | 123 | 404 | 5.0E-15 |
| sp|Q8IVU3|HERC6_HUMAN | Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 | 59 | 348 | 1.0E-14 |
| sp|Q9N1T2|RPGR_CANLF | X-linked retinitis pigmentosa GTPase regulator OS=Canis lupus familiaris GN=RPGR PE=2 SV=1 | 137 | 444 | 3.0E-14 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 21 | 322 | 4.0E-14 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 21 | 322 | 5.0E-14 |
| sp|Q5RCZ7|RCBT2_PONAB | RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 | 154 | 444 | 5.0E-14 |
| sp|O95199|RCBT2_HUMAN | RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 | 154 | 444 | 5.0E-14 |
| sp|Q8TD19|NEK9_HUMAN | Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 | 123 | 450 | 9.0E-14 |
| sp|Q6NYE2|RCC2_DANRE | Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 | 183 | 447 | 9.0E-14 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 173 | 449 | 1.0E-13 |
| sp|Q92834|RPGR_HUMAN | X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 | 137 | 444 | 2.0E-13 |
| sp|Q96I51|WBS16_HUMAN | Williams-Beuren syndrome chromosomal region 16 protein OS=Homo sapiens GN=WBSCR16 PE=1 SV=2 | 86 | 450 | 2.0E-13 |
| sp|Q8K1R7|NEK9_MOUSE | Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 | 139 | 450 | 2.0E-13 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 133 | 442 | 8.0E-13 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 184 | 449 | 9.0E-13 |
| sp|Q9CYF5|WBS16_MOUSE | Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 | 123 | 447 | 9.0E-13 |
| sp|Q8SSY6|SPKUL_DICDI | Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 | 67 | 422 | 9.0E-13 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 21 | 317 | 1.0E-12 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 21 | 318 | 2.0E-12 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 21 | 318 | 2.0E-12 |
| sp|Q9R0X5|RPGR_MOUSE | X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 | 247 | 444 | 2.0E-12 |
| sp|Q9R0X5|RPGR_MOUSE | X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 | 137 | 444 | 3.0E-12 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 70 | 411 | 4.0E-12 |
| sp|Q9R0X5|RPGR_MOUSE | X-linked retinitis pigmentosa GTPase regulator OS=Mus musculus GN=Rpgr PE=1 SV=2 | 192 | 450 | 8.0E-12 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 21 | 322 | 9.0E-12 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 23 | 338 | 1.0E-11 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 21 | 322 | 3.0E-11 |
| sp|Q7ZZC8|NEK9_XENLA | Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 | 123 | 450 | 6.0E-11 |
| sp|Q92834|RPGR_HUMAN | X-linked retinitis pigmentosa GTPase regulator OS=Homo sapiens GN=RPGR PE=1 SV=2 | 247 | 447 | 9.0E-11 |
| sp|Q86SG6|NEK8_HUMAN | Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 | 61 | 343 | 9.0E-11 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 185 | 449 | 1.0E-10 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 123 | 445 | 2.0E-10 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 123 | 445 | 2.0E-10 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 66 | 336 | 2.0E-10 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 136 | 447 | 2.0E-10 |
| sp|Q54Q89|RCCDC_DICDI | RCC1 repeat-containing protein DDB_G0284033 OS=Dictyostelium discoideum GN=DDB_G0284033 PE=3 SV=2 | 21 | 421 | 2.0E-10 |
| sp|Q4R828|RCCD1_MACFA | RCC1 domain-containing protein 1 OS=Macaca fascicularis GN=RCCD1 PE=2 SV=1 | 182 | 444 | 2.0E-10 |
| sp|Q5DX34|RPGRH_CAEEL | X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 | 135 | 446 | 2.0E-10 |
| sp|Q86SG6|NEK8_HUMAN | Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 | 133 | 447 | 3.0E-10 |
| sp|Q90XC2|NEK8_DANRE | Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 | 189 | 447 | 3.0E-10 |
| sp|F2Z461|HERC6_MOUSE | E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 | 303 | 447 | 4.0E-10 |
| sp|Q54VW7|GACGG_DICDI | Rho GTPase-activating protein gacGG OS=Dictyostelium discoideum GN=gacGG PE=3 SV=1 | 56 | 342 | 6.0E-10 |
| sp|Q91ZR4|NEK8_MOUSE | Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 | 133 | 447 | 6.0E-10 |
| sp|F2Z461|HERC6_MOUSE | E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 | 233 | 447 | 8.0E-10 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 58 | 338 | 1.0E-09 |
| sp|Q90XC2|NEK8_DANRE | Serine/threonine-protein kinase Nek8 OS=Danio rerio GN=nek8 PE=2 SV=1 | 61 | 346 | 1.0E-09 |
| sp|Q9P258|RCC2_HUMAN | Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 | 226 | 411 | 1.0E-09 |
| sp|Q6NXM2|RCBT1_MOUSE | RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 | 63 | 334 | 2.0E-09 |
| sp|Q91ZR4|NEK8_MOUSE | Serine/threonine-protein kinase Nek8 OS=Mus musculus GN=Nek8 PE=1 SV=1 | 139 | 449 | 2.0E-09 |
| sp|O42645|YF94_SCHPO | RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 | 67 | 326 | 2.0E-09 |
| sp|D3ZGQ5|NEK8_RAT | Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 | 139 | 449 | 2.0E-09 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 184 | 447 | 3.0E-09 |
| sp|Q8BK67|RCC2_MOUSE | Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 | 226 | 411 | 3.0E-09 |
| sp|A6NED2|RCCD1_HUMAN | RCC1 domain-containing protein 1 OS=Homo sapiens GN=RCCD1 PE=1 SV=1 | 182 | 444 | 3.0E-09 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 184 | 447 | 4.0E-09 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 123 | 446 | 4.0E-09 |
| sp|Q86SG6|NEK8_HUMAN | Serine/threonine-protein kinase Nek8 OS=Homo sapiens GN=NEK8 PE=1 SV=1 | 139 | 449 | 5.0E-09 |
| sp|Q8BTU7|RCCD1_MOUSE | RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 | 182 | 349 | 6.0E-09 |
| sp|Q9CYF5|WBS16_MOUSE | Williams-Beuren syndrome chromosomal region 16 protein homolog OS=Mus musculus GN=Wbscr16 PE=2 SV=1 | 169 | 441 | 7.0E-09 |
| sp|Q9UII4|HERC5_HUMAN | E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 | 132 | 338 | 9.0E-09 |
| sp|Q8K1R7|NEK9_MOUSE | Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 | 145 | 414 | 1.0E-08 |
| sp|Q9P258|RCC2_HUMAN | Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 | 107 | 445 | 1.0E-08 |
| sp|P23800|RCC1_MESAU | Regulator of chromosome condensation OS=Mesocricetus auratus GN=RCC1 PE=1 SV=1 | 197 | 429 | 2.0E-08 |
| sp|Q8VE37|RCC1_MOUSE | Regulator of chromosome condensation OS=Mus musculus GN=Rcc1 PE=1 SV=1 | 203 | 429 | 2.0E-08 |
| sp|Q8NDN9|RCBT1_HUMAN | RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 | 61 | 334 | 2.0E-08 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 208 | 447 | 2.0E-08 |
| sp|Q6NRS1|IBTK_XENLA | Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 | 150 | 343 | 2.0E-08 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 21 | 275 | 3.0E-08 |
| sp|Q8TD19|NEK9_HUMAN | Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 | 232 | 447 | 3.0E-08 |
| sp|Q8TD19|NEK9_HUMAN | Serine/threonine-protein kinase Nek9 OS=Homo sapiens GN=NEK9 PE=1 SV=2 | 145 | 414 | 3.0E-08 |
| sp|Q8K1R7|NEK9_MOUSE | Serine/threonine-protein kinase Nek9 OS=Mus musculus GN=Nek9 PE=1 SV=2 | 232 | 447 | 3.0E-08 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 21 | 275 | 4.0E-08 |
| sp|Q8BK67|RCC2_MOUSE | Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 | 107 | 445 | 4.0E-08 |
| sp|Q5RCZ7|RCBT2_PONAB | RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 | 21 | 334 | 5.0E-08 |
| sp|O95199|RCBT2_HUMAN | RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 | 21 | 334 | 5.0E-08 |
| sp|Q9VR91|HERC2_DROME | Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 | 74 | 337 | 5.0E-08 |
| sp|D3ZGQ5|NEK8_RAT | Serine/threonine-protein kinase Nek8 OS=Rattus norvegicus GN=Nek8 PE=1 SV=1 | 61 | 343 | 8.0E-08 |
| sp|Q15751|HERC1_HUMAN | Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 | 139 | 447 | 1.0E-07 |
| sp|Q5DX34|RPGRH_CAEEL | X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 | 69 | 423 | 1.0E-07 |
| sp|Q8IS20|GEFC_DICDI | Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 | 21 | 262 | 1.0E-07 |
| sp|Q6P798|RCBT2_RAT | RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 | 21 | 334 | 2.0E-07 |
| sp|Q99LJ7|RCBT2_MOUSE | RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 | 21 | 334 | 2.0E-07 |
| sp|Q8BK67|RCC2_MOUSE | Protein RCC2 OS=Mus musculus GN=Rcc2 PE=1 SV=1 | 76 | 333 | 2.0E-07 |
| sp|Q8NDN9|RCBT1_HUMAN | RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 | 20 | 269 | 3.0E-07 |
| sp|Q6ZPR6|IBTK_MOUSE | Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 | 184 | 340 | 3.0E-07 |
| sp|Q52KW8|RCC2_XENLA | Protein RCC2 homolog OS=Xenopus laevis GN=rcc2 PE=2 SV=1 | 64 | 333 | 4.0E-07 |
| sp|P25171|RCC1_DROME | Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 | 21 | 325 | 5.0E-07 |
| sp|Q8IVU3|HERC6_HUMAN | Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 | 297 | 447 | 1.0E-06 |
| sp|F2Z461|HERC6_MOUSE | E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 | 21 | 258 | 1.0E-06 |
| sp|Q9UII4|HERC5_HUMAN | E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 | 21 | 220 | 1.0E-06 |
| sp|Q8SSY6|SPKUL_DICDI | Bifunctional serine/threonine-protein kinase/NEDD4-like E3 ubiquitin-protein ligase OS=Dictyostelium discoideum GN=DDB_G0276527 PE=3 SV=2 | 20 | 261 | 1.0E-06 |
| sp|Q8BTU7|RCCD1_MOUSE | RCC1 domain-containing protein 1 OS=Mus musculus GN=Rccd1 PE=2 SV=2 | 252 | 452 | 1.0E-06 |
| sp|Q9P2D0|IBTK_HUMAN | Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 | 184 | 340 | 1.0E-06 |
| sp|Q6NYE2|RCC2_DANRE | Protein RCC2 homolog OS=Danio rerio GN=rcc2 PE=2 SV=1 | 58 | 333 | 2.0E-06 |
| sp|Q6NRS1|IBTK_XENLA | Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 | 230 | 413 | 2.0E-06 |
| sp|Q9P2D0|IBTK_HUMAN | Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 | 264 | 412 | 2.0E-06 |
| sp|O75592|MYCB2_HUMAN | E3 ubiquitin-protein ligase MYCBP2 OS=Homo sapiens GN=MYCBP2 PE=1 SV=3 | 182 | 338 | 2.0E-06 |
| sp|O42645|YF94_SCHPO | RCC1 repeat-containing protein C10F6.04 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC10F6.04 PE=3 SV=1 | 208 | 444 | 3.0E-06 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 206 | 447 | 4.0E-06 |
| sp|Q7ZZC8|NEK9_XENLA | Serine/threonine-protein kinase Nek9 OS=Xenopus laevis GN=nek9 PE=2 SV=1 | 232 | 440 | 4.0E-06 |
| sp|Q9P258|RCC2_HUMAN | Protein RCC2 OS=Homo sapiens GN=RCC2 PE=1 SV=2 | 76 | 333 | 4.0E-06 |
| sp|Q8IS20|GEFC_DICDI | Ras guanine nucleotide exchange factor C OS=Dictyostelium discoideum GN=gefC PE=2 SV=1 | 281 | 444 | 4.0E-06 |
| sp|Q4U2R1|HERC2_MOUSE | E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 | 265 | 447 | 5.0E-06 |
| sp|O95714|HERC2_HUMAN | E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 | 206 | 447 | 5.0E-06 |
| sp|Q9UII4|HERC5_HUMAN | E3 ISG15--protein ligase HERC5 OS=Homo sapiens GN=HERC5 PE=1 SV=2 | 67 | 319 | 5.0E-06 |
| sp|Q6NXM2|RCBT1_MOUSE | RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 | 20 | 269 | 6.0E-06 |
| sp|Q6NRS1|IBTK_XENLA | Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 | 189 | 340 | 7.0E-06 |
| sp|Q6PAV2|HERC4_MOUSE | Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 | 13 | 228 | 8.0E-06 |
| sp|Q5GLZ8|HERC4_HUMAN | Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 | 13 | 228 | 8.0E-06 |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 26 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 77.92 | 43.40 | 112.45 |
| Initials | Initials knots | 39.02 | 22.52 | 55.53 |
| Pileal_Stipeal_center | Stage I stipe center | 103.86 | 62.21 | 145.52 |
| Pileal_Stipeal_shell | Stage I stipe shell | 36.62 | 21.35 | 51.88 |
| DIF_stipe_center | Stage II stipe center | 96.74 | 57.37 | 136.12 |
| DIF_stipe_shell | Stage II stipe shell | 122.02 | 72.45 | 171.60 |
| DIF_stipe_skin | Stage II stipe skin | 119.05 | 70.53 | 167.57 |
| DIF_cap_skin | Stage II cap skin | 41.77 | 24.47 | 59.06 |
| DIF_cap_tissue | Stage II cap tissue | 45.89 | 27.11 | 64.66 |
| DIF_gill_tissue | Stage II gill tissue | 38.25 | 22.32 | 54.18 |
| YFB_stipe_center | Young fruiting body stipe center | 137.20 | 79.65 | 194.76 |
| YFB_stipe_shell | Young fruiting body stipe shell | 123.05 | 73.32 | 172.78 |
| YFB_stipe_skin | Young fruiting body stipe skin | 141.59 | 83.56 | 199.61 |
| YFB_cap_skin | Young fruiting body cap skin | 40.37 | 23.63 | 57.12 |
| YFB_cap_tissue | Young fruiting body cap tissue | 50.88 | 30.15 | 71.60 |
| YFB_gill_tissue | Young fruiting body gill tissue | 38.19 | 21.63 | 54.76 |
| YFB_veil | Young fruiting body veil | 37.44 | 21.37 | 53.50 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.007782 | yes |
| Casing | YFB_stipe_center | 0.038495 | yes |
| Casing | YFB_stipe_shell | 0.115346 | no |
| Casing | YFB_stipe_skin | 0.027698 | yes |
| Casing | YFB_cap_skin | 0.014956 | yes |
| Casing | YFB_cap_tissue | 0.151786 | no |
| Casing | YFB_gill_tissue | 0.009123 | yes |
| Casing | YFB_veil | 0.006742 | yes |
| Casing | Initials | 0.010412 | yes |
| Casing | Pileal_Stipeal_center | 0.396739 | no |
| Casing | Pileal_Stipeal_shell | 0.004548 | yes |
| Casing | DIF_stipe_center | 0.562908 | no |
| Casing | DIF_stipe_shell | 0.124559 | no |
| Casing | DIF_stipe_skin | 0.151656 | no |
| Casing | DIF_cap_skin | 0.026710 | yes |
| Casing | DIF_cap_tissue | 0.062420 | no |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.918397 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.393342 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.997502 | no |
| DIF_gill_tissue | YFB_veil | 0.969790 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.811107 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.951967 | no |
| YFB_stipe_center | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_veil | 0.000613 | yes |
| YFB_stipe_shell | YFB_stipe_skin | 0.738495 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_veil | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_veil | 0.000613 | yes |
| YFB_cap_skin | YFB_cap_tissue | 0.519530 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.917073 | no |
| YFB_cap_skin | YFB_veil | 0.886639 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.394341 | no |
| YFB_cap_tissue | YFB_veil | 0.363377 | no |
| YFB_gill_tissue | YFB_veil | 0.971907 | no |
| Initials | DIF_gill_tissue | 0.972674 | no |
| Initials | YFB_stipe_center | 0.000613 | yes |
| Initials | YFB_stipe_shell | 0.000613 | yes |
| Initials | YFB_stipe_skin | 0.000613 | yes |
| Initials | YFB_cap_skin | 0.953366 | no |
| Initials | YFB_cap_tissue | 0.449066 | no |
| Initials | YFB_gill_tissue | 0.970686 | no |
| Initials | YFB_veil | 0.945037 | no |
| Initials | Pileal_Stipeal_center | 0.000613 | yes |
| Initials | Pileal_Stipeal_shell | 0.908535 | no |
| Initials | DIF_stipe_center | 0.000613 | yes |
| Initials | DIF_stipe_shell | 0.000613 | yes |
| Initials | DIF_stipe_skin | 0.000613 | yes |
| Initials | DIF_cap_skin | 0.899921 | no |
| Initials | DIF_cap_tissue | 0.699493 | no |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.404591 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.665751 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.326667 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.004928 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_veil | 0.000613 | yes |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.888210 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.689158 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.747197 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.001140 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.938788 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.839658 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.297956 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.939601 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.968823 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.769686 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.532737 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_stipe_center | 0.260183 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.493977 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.201753 | no |
| DIF_stipe_center | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_center | YFB_cap_tissue | 0.012880 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_center | YFB_veil | 0.000613 | yes |
| DIF_stipe_center | DIF_stipe_shell | 0.517682 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.576559 | no |
| DIF_stipe_center | DIF_cap_skin | 0.001140 | yes |
| DIF_stipe_center | DIF_cap_tissue | 0.001140 | yes |
| DIF_stipe_shell | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.793457 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.988247 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.720826 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_veil | 0.000613 | yes |
| DIF_stipe_shell | DIF_stipe_skin | 0.963923 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_shell | DIF_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.736901 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.952971 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.658493 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_veil | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.859662 | no |
| DIF_cap_skin | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.951206 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.605177 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.853996 | no |
| DIF_cap_skin | YFB_veil | 0.820686 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.843512 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.651202 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.000613 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.769420 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.823646 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.645341 | no |
| DIF_cap_tissue | YFB_veil | 0.606480 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|090860 MAQHFNPLPTPPLTARPALVLFAWGAGNFGQFGMGPDVLDSLTTPRRNQWVEAQIGNGTFGEIGAGITAIAAGGL HTLFIDENGTVWSCGANDDAALGRITTNVPNPDKEGLFLDIDELTSWPRPIQTLVDQNFRAVVVAAGDSIGAAVS DEGELRVWGTYRGMEGALGFSSRSEKQQLPTPILTSSRVSSVAAGNNHLVILTTQGYIYTLGSGEQYQLGRKIIE GRKIDGTNPRKIVLGKRLRKAVHVAAGSYHSFAIDENDDVWAWGLNNLGQTGTGWFSEEDNIVYSPQKIESLSRQ NLAGDYVTQIAGGEHHSLFLTSGGKVYSCGRMNGGQLGLQDDNPAIVEWRMKYAEKYGDKLPQLLPTPTQIMFPD ANDPVVQVSAGLHNNAVVTQGGALLAWGQGVQGELGLRKKEEVKTPEVVVRKEGGAWFATAVSCGGQHTIGLFRK KD* |
| Coding | >AgabiH97|090860 ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT CATACGCTTTTTATAGATGAGAATGGGACCGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATC ACTACGAATGTTCCGAATCCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCA ATTCAGACATTAGTTGACCAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGT GATGAAGGTGAACTCCGTGTCTGGGGCACTTACAGGGGTATGGAAGGAGCTCTCGGATTCTCGAGCCGCAGCGAG AAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCCTCGGTGGCTGCAGGCAACAACCATCTCGTC ATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAACAATATCAACTTGGCCGGAAAATCATAGAA GGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGTAAACGTTTGCGTAAAGCCGTCCATGTTGCT GCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTCTGGGCATGGGGATTGAACAATCTGGGCCAA ACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCACCCCAGAAGATCGAGTCCCTCAGCAGACAG AACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCATCATAGTCTTTTCTTGACTTCTGGGGGGAAG GTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGTCTTCAGGATGACAACCCTGCTATCGTGGAGTGGCGG ATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTTCCAACACCAACGCAAATAATGTTTCCGGAT GCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAATGCGGTAGTGACGCAGGGCGGAGCTCTACTA GCATGGGGTCAAGGCGTTCAAGGTGAACTTGGTCTTCGCAAAAAGGAAGAGGTCAAAACGCCGGAGGTTGTTGTG CGTAAAGAGGGTGGTGCTTGGTTTGCGACAGCCGTTTCCTGCGGCGGGCAACATACAATTGGGCTTTTCAGAAAG AAAGACTAG |
| Transcript | >AgabiH97|090860 ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT CATACGCTTTTTATAGATGAGAATGGGACCGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATC ACTACGAATGTTCCGAATCCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCA ATTCAGACATTAGTTGACCAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGT GATGAAGGTGAACTCCGTGTCTGGGGCACTTACAGGGGTATGGAAGGAGCTCTCGGATTCTCGAGCCGCAGCGAG AAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCCTCGGTGGCTGCAGGCAACAACCATCTCGTC ATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAACAATATCAACTTGGCCGGAAAATCATAGAA GGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGTAAACGTTTGCGTAAAGCCGTCCATGTTGCT GCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTCTGGGCATGGGGATTGAACAATCTGGGCCAA ACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCACCCCAGAAGATCGAGTCCCTCAGCAGACAG AACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCATCATAGTCTTTTCTTGACTTCTGGGGGGAAG GTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGTCTTCAGGATGACAACCCTGCTATCGTGGAGTGGCGG ATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTTCCAACACCAACGCAAATAATGTTTCCGGAT GCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAATGCGGTAGTGACGCAGGGCGGAGCTCTACTA GCATGGGGTCAAGGCGTTCAAGGTGAACTTGGTCTTCGCAAAAAGGAAGAGGTCAAAACGCCGGAGGTTGTTGTG CGTAAAGAGGGTGGTGCTTGGTTTGCGACAGCCGTTTCCTGCGGCGGGCAACATACAATTGGGCTTTTCAGAAAG AAAGACTAG |
| Gene | >AgabiH97|090860 ATGGCACAACACTTCAATCCCCTTCCGACCCCACCCTTGACAGCGAGACCCGCTCTTGTCCTATTCGCTTGGGGT GCAGGCAATTTTGGTCAATTTGGCATGGGTCCGGACGTCCTTGACTCATTGACCACGCCACGGAGAAACCAATGG GTCGAGGCTCAGATCGGAAATGGCACATTTGGCGAGATTGGTGCTGGCATAACCGCTATCGCTGCCGGTGGCCTT CATACGCTTTTTATAGATGAGAATGGGACCGTACATTGATTATTCTTTCGCCTCGTTGTCTTCTTGTTTATTGAT TATCTGCCTTAGGTATGGTCCTGCGGTGCTAACGATGATGCTGCCCTTGGTCGAATCACTACGAATGTTCCGAAT CCTGACAAAGAAGGCTTATTCCTTGATATCGATGAGCTCACAAGCTGGCCGCGACCAATTCAGACATTAGTTGAC CAGAATTTCCGCGCTGTAGTTGTCGCCGCTGGTGATAGCATCGGTGCTGCGGTCAGTGATGAAGGTGAACTCCGT GTCTGGGGCACTTACAGGGTAAAATTGTCTCTGTCACTAGCTTCAATTTTCTGAGTATAGTCCCAGGGTATGGAA GGAGCTCTCGGATTCTCGAGCCGCAGCGAGAAACAGCAACTTCCTACACCAATCCTCACGTCAAGCCGGGTTTCC TCGGTGGCTGCAGGCAACAACCATCTCGTCATTCTCACAACTCAAGGTTACATTTATACCCTTGGATCCGGTGAA CAATATCAACTTGGCCGGAAAATCATAGAAGGTCGGAAGATAGACGGAACTAACCCAAGAAAAATTGTTCTTGGT AAACGTTTGCGTAAAGCCGTCCATGTTGCTGCCGGTTCTTACCACTCTTTCGCCATCGATGAGAATGATGATGTC TGGGCATGGGGATTGAACAATCTGGGCCAAACTGGTACCGGCTGGTTCTCGGAGGAGGATAATATCGTATATTCA CCCCAGAAGATCGAGTCCCTCAGCAGACAGAACCTTGCAGGCGATTACGTGACTCAAATTGCTGGAGGCGAGCAT CATAGTCTTTTCTTGACTTCTGGGGGGAAGGTATATTCTTGTGGACGTATGAATGGCGGTCAACTTGGTCTTCAG GATGACAACCCTGCTATCGTGGAGTGGCGGATGAAGTATGCCGAGAAGTATGGAGATAAACTTCCACAACTACTT CCAACACCAACGCAAATAATGTTTCCGGATGCCAACGATCCTGTTGTCCAGGTATCTGCTGGCTTGCACAACAAT GCGGTAGTGACGCAGGGCGGAGCTCTACTAGCATGGGGTCAAGGCGTTCAAGGTGAACTTGGTCTTCGCAAAAAG GAAGAGGTCAAAACGCCGGAGGTTGTTGTGCGTAAAGAGGGTGGTGCTTGGTTTGCGACAGCCGTTTCCTGCGGC GGGCAACATACAATTGGGCTTTTCAGAAAGAAAGACTAG |