Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090760
Gene name
Locationscaffold_6:653902..655533
Strand-
Gene length (bp)1631
Transcript length (bp)1044
Coding sequence length (bp)1044
Protein length (aa) 348

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00013 KH_1 KH domain 1.0E-06 137 198

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q09911|YAJE_SCHPO Uncharacterized protein C30D11.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.14c PE=4 SV=1 67 253 5.0E-31
sp|Q3TCX3|K0907_MOUSE UPF0469 protein KIAA0907 OS=Mus musculus GN=Kiaa0907 PE=1 SV=1 48 219 6.0E-23
sp|A0JM64|K0907_XENTR UPF0469 protein KIAA0907 homolog OS=Xenopus tropicalis PE=2 SV=1 58 259 2.0E-22
sp|Q7Z7F0|K0907_HUMAN UPF0469 protein KIAA0907 OS=Homo sapiens GN=KIAA0907 PE=1 SV=1 48 219 2.0E-22
sp|Q2NLB0|K0907_XENLA UPF0469 protein KIAA0907 homolog OS=Xenopus laevis PE=2 SV=1 58 219 3.0E-22
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q09911|YAJE_SCHPO Uncharacterized protein C30D11.14c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC30D11.14c PE=4 SV=1 67 253 5.0E-31
sp|Q3TCX3|K0907_MOUSE UPF0469 protein KIAA0907 OS=Mus musculus GN=Kiaa0907 PE=1 SV=1 48 219 6.0E-23
sp|A0JM64|K0907_XENTR UPF0469 protein KIAA0907 homolog OS=Xenopus tropicalis PE=2 SV=1 58 259 2.0E-22
sp|Q7Z7F0|K0907_HUMAN UPF0469 protein KIAA0907 OS=Homo sapiens GN=KIAA0907 PE=1 SV=1 48 219 2.0E-22
sp|Q2NLB0|K0907_XENLA UPF0469 protein KIAA0907 homolog OS=Xenopus laevis PE=2 SV=1 58 219 3.0E-22
sp|Q5ZL54|K0907_CHICK UPF0469 protein KIAA0907 homolog OS=Gallus gallus GN=RCJMB04_7l9 PE=2 SV=1 58 219 4.0E-22
sp|Q6NZ18|K0907_DANRE UPF0469 protein KIAA0907 homolog OS=Danio rerio PE=2 SV=1 47 220 1.0E-21
sp|Q9LIA4|RIK_ARATH Protein RIK OS=Arabidopsis thaliana GN=RIK PE=1 SV=2 73 209 8.0E-13
sp|Q32SG5|RIK_MAIZE Protein RIK OS=Zea mays PE=1 SV=1 73 209 4.0E-08
[Show less]

GO

GO Term Description Terminal node
GO:0003723 RNA binding Yes
GO:0003674 molecular_function No
GO:0005488 binding No
GO:0097159 organic cyclic compound binding No
GO:1901363 heterocyclic compound binding No
GO:0003676 nucleic acid binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 67 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090760
MSSKSKWDQPAPAEDAGAKESKNSAKGANDAAAAAAAIAAKIAAQFAAGAFKDEEGVLSKRSKRKRATEKDPPLF
LHIAAPTQEALQKAIDKVNELLSVDLGSLVEDKKDKLRDKRRWPEDKLPVGLESIRNFNVRAKVVGPSGCYVKYI
QQETGARVQIKGFGSGFIEQETGKESEEPLYIHITGPDEGQVEKAKVLTEDLLLVVRQEHAKMQCFLNQQQMELH
QAQAQYAAYSAMAAGYAPPQPSNAPPPPPGEQPPPPADGAPPKGGAYDPSQSAPPAGSNHDAFSAYWAAYGYDVN
SPQFKEWVSQQTQYAQYPVQPGHNGVNGGAPPPPPGSGDAPPPPPPS*
Coding >AgabiH97|090760
ATGTCCTCTAAAAGCAAGTGGGACCAACCAGCACCTGCAGAAGATGCCGGAGCTAAAGAAAGCAAAAACTCTGCC
AAAGGTGCAAACGACGCCGCCGCAGCCGCAGCGGCAATTGCTGCCAAAATTGCTGCCCAATTTGCCGCTGGTGCA
TTCAAAGATGAAGAGGGAGTACTCAGCAAGAGATCCAAGAGGAAACGGGCCACCGAGAAGGATCCTCCTTTGTTC
CTCCACATCGCCGCTCCAACCCAAGAGGCGCTACAAAAAGCCATCGATAAGGTCAATGAACTCTTGAGTGTGGAT
CTTGGATCGCTTGTAGAAGACAAGAAGGACAAATTGAGGGACAAGCGTCGATGGCCTGAAGATAAACTTCCCGTC
GGGTTAGAGTCTATTCGGAACTTCAACGTTCGAGCCAAAGTCGTCGGACCATCAGGCTGCTATGTCAAGTATATC
CAACAAGAAACCGGCGCTCGTGTTCAAATCAAAGGATTCGGCTCAGGTTTTATTGAACAAGAGACGGGTAAAGAA
AGCGAGGAGCCGCTATACATCCATATTACAGGTCCGGATGAGGGTCAAGTTGAGAAGGCGAAAGTTCTCACCGAG
GATTTACTTCTAGTCGTCCGGCAAGAACATGCGAAAATGCAGTGTTTCCTCAATCAACAACAAATGGAACTTCAT
CAAGCTCAAGCCCAGTATGCTGCATACAGTGCCATGGCAGCGGGATACGCGCCCCCGCAACCATCCAATGCGCCT
CCGCCACCTCCTGGAGAACAACCGCCTCCACCTGCCGATGGCGCACCTCCTAAAGGAGGAGCATATGATCCCTCT
CAAAGTGCCCCACCAGCAGGATCCAATCACGACGCCTTTTCCGCTTACTGGGCGGCGTATGGATACGACGTGAAT
TCGCCTCAATTCAAAGAATGGGTCAGTCAACAGACTCAATACGCGCAATATCCTGTGCAACCAGGACACAACGGT
GTCAATGGTGGTGCGCCTCCGCCTCCACCAGGCTCTGGAGACGCTCCGCCTCCGCCCCCTCCATCATAA
Transcript >AgabiH97|090760
ATGTCCTCTAAAAGCAAGTGGGACCAACCAGCACCTGCAGAAGATGCCGGAGCTAAAGAAAGCAAAAACTCTGCC
AAAGGTGCAAACGACGCCGCCGCAGCCGCAGCGGCAATTGCTGCCAAAATTGCTGCCCAATTTGCCGCTGGTGCA
TTCAAAGATGAAGAGGGAGTACTCAGCAAGAGATCCAAGAGGAAACGGGCCACCGAGAAGGATCCTCCTTTGTTC
CTCCACATCGCCGCTCCAACCCAAGAGGCGCTACAAAAAGCCATCGATAAGGTCAATGAACTCTTGAGTGTGGAT
CTTGGATCGCTTGTAGAAGACAAGAAGGACAAATTGAGGGACAAGCGTCGATGGCCTGAAGATAAACTTCCCGTC
GGGTTAGAGTCTATTCGGAACTTCAACGTTCGAGCCAAAGTCGTCGGACCATCAGGCTGCTATGTCAAGTATATC
CAACAAGAAACCGGCGCTCGTGTTCAAATCAAAGGATTCGGCTCAGGTTTTATTGAACAAGAGACGGGTAAAGAA
AGCGAGGAGCCGCTATACATCCATATTACAGGTCCGGATGAGGGTCAAGTTGAGAAGGCGAAAGTTCTCACCGAG
GATTTACTTCTAGTCGTCCGGCAAGAACATGCGAAAATGCAGTGTTTCCTCAATCAACAACAAATGGAACTTCAT
CAAGCTCAAGCCCAGTATGCTGCATACAGTGCCATGGCAGCGGGATACGCGCCCCCGCAACCATCCAATGCGCCT
CCGCCACCTCCTGGAGAACAACCGCCTCCACCTGCCGATGGCGCACCTCCTAAAGGAGGAGCATATGATCCCTCT
CAAAGTGCCCCACCAGCAGGATCCAATCACGACGCCTTTTCCGCTTACTGGGCGGCGTATGGATACGACGTGAAT
TCGCCTCAATTCAAAGAATGGGTCAGTCAACAGACTCAATACGCGCAATATCCTGTGCAACCAGGACACAACGGT
GTCAATGGTGGTGCGCCTCCGCCTCCACCAGGCTCTGGAGACGCTCCGCCTCCGCCCCCTCCATCATAA
Gene >AgabiH97|090760
ATGTCCTCTAAAAGCAAGTGGGACCAACCAGCACCTGCAGAAGATGCCGGAGCTAAAGAAAGCAAAAACTCTGCC
AAAGGTGCAAACGACGCCGCCGCAGCCGCAGCGGCAATTGCTGCCAAAATTGCTGCCCAATTTGCCGCTGGTGCA
TTCAAAGATGAAGGTGCATTCCAGAAGGATATCGATATCAACGACGTGCGCAATCGATACATGCTAACTAGAGGG
AGTACTCAGCAAGAGGTTCGTTCTTCTAATCCTTTACCTTGGTTTGCGTTTACACCCATGTCGACTGTTGTTGTT
GTTTTAGATCCAAGAGGAAACGGGTGCGTCGGTCAGCACGAAAGGGGTGTGGTATCCTGACCGGAGCAAGGCCAC
CGAGAAGGATCCTCCTTTGTTCCTCCACATCGCCGCTCCAACCCAAGAGGCGCTACAAAAAGCCATCGATAAGGT
CAATGAACTCTTGAGTGTGGATCTTGGATCGCTTGTAGAAGACAAGAAGGACAAATTGAGGGACAAGGTGGTGTA
CCCTCTTGGCTAATTCTCCGTCAATGGCCGACCTGTTAGCCTATTCCCAACAGCGTCGATGGCCTGAAGATAAAC
TTCCCGTCGGGTTAGAGTCTATTCGGAACTTCAACGTTCGAGCCAAAGTCGTCGGACCATCAGTACGCCAACCCT
TTTGACTTTGATTTGTTTTTCGCTTCTAGAAGACTAATCTATCCATTCTTTGTGTAGGGCTGCTATGTCAAGTAT
ATCCAACAAGAAACCGGCGCTCGTGTTCAAATCAAAGGATTCGGCTCAGGTTTTATTGAACAAGAGACGGGTAAA
GAAAGCGAGGAGCCGCTATACATCCATATTACGTGCGTCGTCTGGATTCTTTTCACCAGTAATTTGTGATCGTCT
CATCAAATTTTTTGACCATAGAGGTCCGGATGAGGGTCAAGTTGAGAAGGCGAAAGTTCTCACCGAGGATTTACT
TCTAGTCGTCCGGCAAGAACATGCGAAAATGCAGTGTTTCCTCAATCAACAACAAATGGAACTTCATCAAGCTCA
AGCCCAGTATGCTGCATACAGTGCCATGGCAGCGGTAGGTACTTTTTCTATGTGGGTCCGTCAAACGGGCTGTTT
TCTCTACTTTCTCCATTTTCATGGAACGGTTTACTGACGAACCTTCTGCTGACTTTCCTCCGTTCATCGTCTTGT
TATATATTTCCGTATTGATGCATAGGGATACGCGCCCCCGCAACCATCCAATGCGCCTCCGCCACCTCCTGGAGA
ACAACCGCCTCCACCTGCCGATGGCGCACCTCCTAAAGGAGGAGCATATGATCCCTCTCAAAGTGCCCCACCAGC
AGGATCCAATCACGACGCCTTTTCCGCTTACTGGTAACGAACTCTTCCGATTTTTTCTTCTCACAAATCATATCT
ATTCACCTCTCCTTCTTTTGTTATTTTTTGTTTTTAGGGCGGCGTATGGATACGACGTGAATTCGCCTCAATTCA
AAGAATGGGTCAGTCAACAGACTCAATACGCGCAATATCCTGTGCAACCAGGACACAACGGTGTCAATGGTGGTG
CGCCTCCGCCTCCACCAGGCTCTGGAGACGCTCCGCCTCCGCCCCCTCCATCATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail