Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090740
Gene name
Locationscaffold_6:646703..652574
Strand+
Gene length (bp)5871
Transcript length (bp)4968
Coding sequence length (bp)4968
Protein length (aa) 1656

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00780 CNH CNH domain 1.7E-63 1258 1543
PF00621 RhoGEF RhoGEF domain 9.7E-31 612 796
PF00621 RhoGEF RhoGEF domain 5.8E-30 839 1021
PF15405 PH_5 Pleckstrin homology domain 2.9E-15 1062 1196
PF00169 PH PH domain 6.9E-07 1063 1199

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 817 1548 2.0E-90
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 817 1549 2.0E-74
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 831 1541 2.0E-67
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 817 1555 1.0E-57
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 801 1543 1.0E-45
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 817 1548 2.0E-90
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 817 1549 2.0E-74
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 831 1541 2.0E-67
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 817 1555 1.0E-57
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 801 1543 1.0E-45
sp|Q9Y7U6|RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf1 PE=1 SV=1 416 796 6.0E-42
sp|Q9UTR5|RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf2 PE=1 SV=1 417 805 2.0E-33
sp|Q9Y7U5|RGF3_SCHPO Rho1 guanine nucleotide exchange factor 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=rgf3 PE=1 SV=1 533 793 1.0E-27
sp|P53046|ROM1_YEAST RHO1 GDP-GTP exchange protein 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM1 PE=1 SV=2 422 794 4.0E-25
sp|P51862|ROM2_YEAST RHO1 GDP-GTP exchange protein 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ROM2 PE=1 SV=1 534 820 1.0E-24
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 817 1212 5.0E-21
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 817 1191 3.0E-19
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 817 1191 1.0E-18
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 817 1198 1.0E-18
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 817 1198 1.0E-18
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 825 1127 1.0E-17
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 825 1127 1.0E-17
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 817 1200 2.0E-16
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 817 1141 2.0E-16
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 817 1068 6.0E-15
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 595 796 1.0E-14
sp|Q15811|ITSN1_HUMAN Intersectin-1 OS=Homo sapiens GN=ITSN1 PE=1 SV=3 595 796 2.0E-14
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 817 1068 2.0E-14
sp|Q9Z0R4|ITSN1_MOUSE Intersectin-1 OS=Mus musculus GN=Itsn1 PE=1 SV=2 595 796 3.0E-14
sp|Q9NZM3|ITSN2_HUMAN Intersectin-2 OS=Homo sapiens GN=ITSN2 PE=1 SV=3 833 1129 3.0E-14
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 817 1068 8.0E-14
sp|Q3U5C8|ARHGG_MOUSE Rho guanine nucleotide exchange factor 16 OS=Mus musculus GN=Arhgef16 PE=1 SV=3 812 1219 1.0E-13
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 836 1108 3.0E-13
sp|Q8IW93|ARHGJ_HUMAN Rho guanine nucleotide exchange factor 19 OS=Homo sapiens GN=ARHGEF19 PE=1 SV=1 819 1110 5.0E-13
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 836 1108 8.0E-13
sp|Q96DR7|ARHGQ_HUMAN Rho guanine nucleotide exchange factor 26 OS=Homo sapiens GN=ARHGEF26 PE=1 SV=4 825 1225 9.0E-13
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 817 1068 1.0E-12
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 812 1068 1.0E-12
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 833 1127 2.0E-12
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 813 1541 2.0E-12
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 604 787 3.0E-12
sp|Q9Z0R6|ITSN2_MOUSE Intersectin-2 OS=Mus musculus GN=Itsn2 PE=1 SV=2 595 796 4.0E-12
sp|O15085|ARHGB_HUMAN Rho guanine nucleotide exchange factor 11 OS=Homo sapiens GN=ARHGEF11 PE=1 SV=1 583 805 5.0E-12
sp|Q55E26|GXCB_DICDI Rac guanine nucleotide exchange factor B OS=Dictyostelium discoideum GN=gxcB PE=2 SV=1 826 1068 6.0E-12
sp|Q5DU57|SPT13_MOUSE Spermatogenesis-associated protein 13 OS=Mus musculus GN=Spata13 PE=1 SV=2 836 1126 8.0E-12
sp|Q9N0A8|ARHG3_MACFA Rho guanine nucleotide exchange factor 3 OS=Macaca fascicularis GN=ARHGEF3 PE=2 SV=1 582 802 1.0E-11
sp|Q9NR81|ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens GN=ARHGEF3 PE=1 SV=1 582 802 1.0E-11
sp|Q5R6F2|ARHG3_PONAB Rho guanine nucleotide exchange factor 3 OS=Pongo abelii GN=ARHGEF3 PE=2 SV=1 582 802 1.0E-11
sp|Q91X46|ARHG3_MOUSE Rho guanine nucleotide exchange factor 3 OS=Mus musculus GN=Arhgef3 PE=1 SV=1 582 802 2.0E-11
sp|Q9Z1I6|ARHG1_RAT Rho guanine nucleotide exchange factor 1 OS=Rattus norvegicus GN=Arhgef1 PE=2 SV=1 580 807 2.0E-11
sp|Q9ES67|ARHGB_RAT Rho guanine nucleotide exchange factor 11 OS=Rattus norvegicus GN=Arhgef11 PE=1 SV=1 583 805 2.0E-11
sp|Q96N96|SPT13_HUMAN Spermatogenesis-associated protein 13 OS=Homo sapiens GN=SPATA13 PE=1 SV=1 796 1126 2.0E-11
sp|Q8C033|ARHGA_MOUSE Rho guanine nucleotide exchange factor 10 OS=Mus musculus GN=Arhgef10 PE=1 SV=2 827 1036 2.0E-11
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 609 853 2.0E-11
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 836 1099 3.0E-11
sp|Q7Z628|ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens GN=NET1 PE=1 SV=1 582 801 4.0E-11
sp|Q5ZLX4|ARHG3_CHICK Rho guanine nucleotide exchange factor 3 OS=Gallus gallus GN=Arhgef3 PE=2 SV=1 590 802 5.0E-11
sp|Q8BWA8|ARHGJ_MOUSE Rho guanine nucleotide exchange factor 19 OS=Mus musculus GN=Arhgef19 PE=1 SV=1 819 1196 6.0E-11
sp|Q9Z206|ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus GN=Net1 PE=1 SV=2 574 801 1.0E-10
sp|Q12774|ARHG5_HUMAN Rho guanine nucleotide exchange factor 5 OS=Homo sapiens GN=ARHGEF5 PE=1 SV=3 825 1108 1.0E-10
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 827 1036 1.0E-10
sp|Q61210|ARHG1_MOUSE Rho guanine nucleotide exchange factor 1 OS=Mus musculus GN=Arhgef1 PE=1 SV=2 580 807 2.0E-10
sp|Q92888|ARHG1_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens GN=ARHGEF1 PE=1 SV=2 580 807 2.0E-10
sp|Q5VV41|ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens GN=ARHGEF16 PE=1 SV=1 812 1105 4.0E-10
sp|Q008S8|ECT2L_HUMAN Epithelial cell-transforming sequence 2 oncogene-like OS=Homo sapiens GN=ECT2L PE=2 SV=2 835 1017 1.0E-09
sp|E9Q7D5|ARHG5_MOUSE Rho guanine nucleotide exchange factor 5 OS=Mus musculus GN=Arhgef5 PE=1 SV=1 825 1108 1.0E-09
sp|O15013|ARHGA_HUMAN Rho guanine nucleotide exchange factor 10 OS=Homo sapiens GN=ARHGEF10 PE=1 SV=4 574 794 2.0E-09
sp|Q9NXL2|ARH38_HUMAN Rho guanine nucleotide exchange factor 38 OS=Homo sapiens GN=ARHGEF38 PE=2 SV=2 609 795 3.0E-09
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 817 1069 4.0E-09
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 589 775 6.0E-09
sp|Q8R4H2|ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus GN=Arhgef12 PE=1 SV=2 589 797 8.0E-09
sp|Q9NZN5|ARHGC_HUMAN Rho guanine nucleotide exchange factor 12 OS=Homo sapiens GN=ARHGEF12 PE=1 SV=1 817 1069 8.0E-09
sp|Q8N1W1|ARG28_HUMAN Rho guanine nucleotide exchange factor 28 OS=Homo sapiens GN=ARHGEF28 PE=1 SV=3 586 801 9.0E-09
sp|Q5BKC9|NGEF_RAT Ephexin-1 OS=Rattus norvegicus GN=Ngef PE=1 SV=2 817 1166 1.0E-08
sp|Q96M96|FGD4_HUMAN FYVE, RhoGEF and PH domain-containing protein 4 OS=Homo sapiens GN=FGD4 PE=1 SV=2 833 1266 1.0E-08
sp|Q12802|AKP13_HUMAN A-kinase anchor protein 13 OS=Homo sapiens GN=AKAP13 PE=1 SV=2 580 794 2.0E-08
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 609 801 2.0E-08
sp|Q96PE2|ARHGH_HUMAN Rho guanine nucleotide exchange factor 17 OS=Homo sapiens GN=ARHGEF17 PE=1 SV=1 609 794 3.0E-08
sp|Q7Z6J4|FGD2_HUMAN FYVE, RhoGEF and PH domain-containing protein 2 OS=Homo sapiens GN=FGD2 PE=1 SV=1 817 1266 3.0E-08
sp|Q9NR80|ARHG4_HUMAN Rho guanine nucleotide exchange factor 4 OS=Homo sapiens GN=ARHGEF4 PE=1 SV=3 609 861 4.0E-08
sp|O88387|FGD4_RAT FYVE, RhoGEF and PH domain-containing protein 4 OS=Rattus norvegicus GN=Fgd4 PE=1 SV=1 833 1269 5.0E-08
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 609 796 5.0E-08
sp|Q9H7P9|PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens GN=PLEKHG2 PE=1 SV=3 839 1002 5.0E-08
sp|Q91ZT5|FGD4_MOUSE FYVE, RhoGEF and PH domain-containing protein 4 OS=Mus musculus GN=Fgd4 PE=1 SV=1 833 1269 6.0E-08
sp|Q6KAU7|PKHG2_MOUSE Pleckstrin homology domain-containing family G member 2 OS=Mus musculus GN=Plekhg2 PE=2 SV=2 832 1002 6.0E-08
sp|Q60875|ARHG2_MOUSE Rho guanine nucleotide exchange factor 2 OS=Mus musculus GN=Arhgef2 PE=1 SV=4 586 796 7.0E-08
sp|Q14155|ARHG7_HUMAN Rho guanine nucleotide exchange factor 7 OS=Homo sapiens GN=ARHGEF7 PE=1 SV=2 612 820 8.0E-08
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 824 1101 9.0E-08
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 798 1020 9.0E-08
sp|Q80U35|ARHGH_MOUSE Rho guanine nucleotide exchange factor 17 OS=Mus musculus GN=Arhgef17 PE=1 SV=2 609 794 1.0E-07
sp|Q06412|TUS1_YEAST Rho1 guanine nucleotide exchange factor TUS1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TUS1 PE=1 SV=1 450 795 1.0E-07
sp|Q70Z35|PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens GN=PREX2 PE=2 SV=1 609 796 1.0E-07
sp|Q8IVF5|TIAM2_HUMAN T-lymphoma invasion and metastasis-inducing protein 2 OS=Homo sapiens GN=TIAM2 PE=2 SV=4 610 796 1.0E-07
sp|P97433|ARG28_MOUSE Rho guanine nucleotide exchange factor 28 OS=Mus musculus GN=Arhgef28 PE=1 SV=1 586 801 1.0E-07
sp|B2DCZ9|ARHG2_PIG Rho guanine nucleotide exchange factor 2 OS=Sus scrofa GN=ARHGEF2 PE=2 SV=1 588 796 1.0E-07
sp|Q9TW28|MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum GN=myoM PE=1 SV=1 836 1095 2.0E-07
sp|Q69ZK0|PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus GN=Prex1 PE=1 SV=2 836 1101 2.0E-07
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 837 1020 2.0E-07
sp|Q8CHT1|NGEF_MOUSE Ephexin-1 OS=Mus musculus GN=Ngef PE=1 SV=1 817 1166 3.0E-07
sp|Q865S3|ARHG2_CANLF Rho guanine nucleotide exchange factor 2 OS=Canis lupus familiaris GN=ARHGEF2 PE=1 SV=1 588 796 3.0E-07
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 829 1101 3.0E-07
sp|Q86VW2|ARHGP_HUMAN Rho guanine nucleotide exchange factor 25 OS=Homo sapiens GN=ARHGEF25 PE=1 SV=2 822 1142 4.0E-07
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 609 861 4.0E-07
sp|Q6ZPF3|TIAM2_MOUSE T-lymphoma invasion and metastasis-inducing protein 2 OS=Mus musculus GN=Tiam2 PE=1 SV=2 610 796 5.0E-07
sp|Q5RDX5|NGEF_PONAB Ephexin-1 OS=Pongo abelii GN=NGEF PE=2 SV=1 817 1166 5.0E-07
sp|Q8N5V2|NGEF_HUMAN Ephexin-1 OS=Homo sapiens GN=NGEF PE=1 SV=2 817 1166 5.0E-07
sp|Q8TCU6|PREX1_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Homo sapiens GN=PREX1 PE=1 SV=3 609 796 5.0E-07
sp|P0C6P5|ARG28_RAT Rho guanine nucleotide exchange factor 28 OS=Rattus norvegicus GN=Arhgef28 PE=1 SV=1 586 801 5.0E-07
sp|Q54B37|GXCJ_DICDI RhoGEF domain-containing protein gxcJ OS=Dictyostelium discoideum GN=gxcJ PE=3 SV=1 609 807 6.0E-07
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 602 796 7.0E-07
sp|Q6ZV73|FGD6_HUMAN FYVE, RhoGEF and PH domain-containing protein 6 OS=Homo sapiens GN=FGD6 PE=1 SV=2 842 1016 8.0E-07
sp|Q6XZF7|DNMBP_HUMAN Dynamin-binding protein OS=Homo sapiens GN=DNMBP PE=1 SV=1 609 795 8.0E-07
sp|Q9HCE6|ARGAL_HUMAN Rho guanine nucleotide exchange factor 10-like protein OS=Homo sapiens GN=ARHGEF10L PE=1 SV=3 827 1022 8.0E-07
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 821 1101 8.0E-07
sp|Q1LUA6|TRIO_DANRE Triple functional domain protein OS=Danio rerio GN=trio PE=3 SV=1 835 1172 9.0E-07
sp|Q865S3|ARHG2_CANLF Rho guanine nucleotide exchange factor 2 OS=Canis lupus familiaris GN=ARHGEF2 PE=1 SV=1 817 1122 1.0E-06
sp|Q3LAC4|PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus GN=Prex2 PE=1 SV=2 609 796 1.0E-06
sp|Q8BY35|FGD2_MOUSE FYVE, RhoGEF and PH domain-containing protein 2 OS=Mus musculus GN=Fgd2 PE=1 SV=1 784 1266 1.0E-06
sp|Q60992|VAV2_MOUSE Guanine nucleotide exchange factor VAV2 OS=Mus musculus GN=Vav2 PE=1 SV=1 817 1035 1.0E-06
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 821 1126 1.0E-06
sp|P27671|RGRF1_MOUSE Ras-specific guanine nucleotide-releasing factor 1 OS=Mus musculus GN=Rasgrf1 PE=1 SV=2 788 1070 1.0E-06
sp|Q80VK6|ARH38_MOUSE Rho guanine nucleotide exchange factor 38 OS=Mus musculus GN=Arhgef38 PE=1 SV=2 822 1059 2.0E-06
sp|Q1ZXH8|GXCDD_DICDI Guanine exchange factor for Rac 30 OS=Dictyostelium discoideum GN=gxcDD PE=3 SV=3 835 1099 2.0E-06
sp|Q07139|ECT2_MOUSE Protein ECT2 OS=Mus musculus GN=Ect2 PE=1 SV=2 602 796 2.0E-06
sp|Q69ZL1|FGD6_MOUSE FYVE, RhoGEF and PH domain-containing protein 6 OS=Mus musculus GN=Fgd6 PE=1 SV=2 839 1016 2.0E-06
sp|Q29RM4|ARGAL_BOVIN Rho guanine nucleotide exchange factor 10-like protein OS=Bos taurus GN=ARHGEF10L PE=2 SV=1 829 1022 3.0E-06
sp|Q6TXD4|DNMBP_MOUSE Dynamin-binding protein OS=Mus musculus GN=Dnmbp PE=1 SV=2 609 795 3.0E-06
sp|Q7TNR9|ARHG4_MOUSE Rho guanine nucleotide exchange factor 4 OS=Mus musculus GN=Arhgef4 PE=2 SV=2 832 1126 4.0E-06
sp|Q9H8V3|ECT2_HUMAN Protein ECT2 OS=Homo sapiens GN=ECT2 PE=1 SV=4 829 1101 4.0E-06
sp|Q5ZLR6|ARHG6_CHICK Rho guanine nucleotide exchange factor 6 OS=Gallus gallus GN=ARHGEF6 PE=2 SV=1 584 820 4.0E-06
sp|Q5R5M3|ARGAL_PONAB Rho guanine nucleotide exchange factor 10-like protein OS=Pongo abelii GN=ARHGEF10L PE=2 SV=1 827 1022 4.0E-06
sp|Q9ES28|ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus GN=Arhgef7 PE=1 SV=2 612 799 5.0E-06
sp|Q13972|RGRF1_HUMAN Ras-specific guanine nucleotide-releasing factor 1 OS=Homo sapiens GN=RASGRF1 PE=1 SV=2 788 1074 8.0E-06
sp|Q6ZSZ5|ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens GN=ARHGEF18 PE=1 SV=3 577 809 8.0E-06
sp|P52735|VAV2_HUMAN Guanine nucleotide exchange factor VAV2 OS=Homo sapiens GN=VAV2 PE=1 SV=2 835 1043 9.0E-06
sp|P11274|BCR_HUMAN Breakpoint cluster region protein OS=Homo sapiens GN=BCR PE=1 SV=2 568 788 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005085 guanyl-nucleotide exchange factor activity Yes
GO:0003674 molecular_function No
GO:0060589 nucleoside-triphosphatase regulator activity No
GO:0030695 GTPase regulator activity No
GO:0030234 enzyme regulator activity No
GO:0098772 molecular function regulator activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090740
MPPSPSATGSRSAVDEDLQKLYNDVLAGFDAEVPSLSLNDNTSPGYIYGDYGDASNNENRNGDVNAPISHHSYDK
YTPTSPTSVLSHSSQLSDPPNFSRPGAVRRLPPTPGSSNTEFSATSPSMSMPDPEPYFDPYVAFVPPTTKRAPVS
STGRRLPITPDQASVVASSYNRPPLPGLPSSQRPSAFHVPTYSSSSVHGPYSPEKAPDGLEDGESALEQVLTMSP
TFHDSESTFQPPQVNVDHADNDTKIVDHGHHYSYSQPVVQPRAPSYGHSPSRSFVTSPSSQNREYMMPQPEVASL
GRSSSLTPYGDSLSVRSVSSSHVPQLGQSSSSRNPTPSVGESSTYKGSRVDVPPRTPEEDDSFVAPPSPMQEQTY
GEVRGPSEALHTLADFENPGTHDVQDPVEDYWDDAEEDGDRFINYFLLSHIAVQLRDKIPRGTHVKGSIPYHRGF
TGKDIVSTIQALIQRDLAITYGISTNDRRVALQVARSLQNQLFFFEVEWGGRILQDGVEDVFMFYDEQDGGSDAI
FEKEELPTGVVTMLTRCYSPSCADSGLEGPPCYSYSCPKREHGQKSGLSVVSAVLESPVEEKDSWTKGIDEQVLS
ALPENEISRQSIIHQLIGKEEQYIADLDTVETMFIKPLRAAKPSVLPEVEDFIEEVFGNILDLRECNRRLLEVLY
VRQREQGPIIQRIGDVFLNAAVEFRLAYPTYIGHHMTAEKRLKEEQENNGAFKFFLEDCTRKTGRQGEPIRLDLK
HFLNRPSDHLQKYPVLLEAILEKTEEENPDAEFLKEAISTIKSLHSFAQLKTFQTAMGKGAPGKWEWHDVVSPEL
MKSLPKKEVKRQAVIFELIKGEMAYVKDLENIRLMYVDPLRSANPPIIPGNRLEQFINDVFHNYWDIFSHHRRLM
EKLHEIQREHHPCVQSITAAMFDAALNFRDAYLEYIPHYPIGAYRIDDEMANNPAFKAFIDQQTRHPDAHRLDMK
NFINRPIPRLLRYELLLKDIMHNSAEGHEDHADIPNVIDAIKSLGKETEPGVQDAKTKVELWRYNANLVFKHGET
FDMDLLDEKRQLVHSGKLLRQPDSGLEWNGWSELFVLLFDNYLVLTKQREKDGVMKYNVYKRPIPLDLVTLVNFT
DPPTQRNAGLLRGLRGGERNEPPAFSASPDTSTDSKFVFSMTLHHNGRAGGTYILYAETSQSRSEWQAKLNHALA
MHKAVQDSNKVFEVETLSADTFSMPLLPTAASGPAWSQDNAITGKVTCSVPFNTADGRRLVAIGCAEGVWIGFRH
DPRSLRRVLHLRQVTQCAMLEEFSIFLVLADKSLFAYHLEALVPSAPNLAHQNVPQKLNGNKDVHFFSVGTLHGR
TLVVYMKKKNLDSIFRVLEPVGDKINERVKAPVGLGSRLGFRSTKSEWFRVYRDFFLPSESYDMIFLKARIAILC
AKGFEIMDLNDFNSVTIPQREDPRLSHLAKRCESCRPLGMFRSADDEFLLCYDEFGVYVDKHGDPSRSAGTIEWE
GTAERVALHHPYILLFDSRFIEVRHVETGRLAQIIPGNDIRCIWDGRGVSTNLSIPTTVSEEMAQEAQVHAVMTN
PDQGPMSVGRPKTIPQCVFELIPTIPLYPPPPPPPKNEMNSAIANPMANGSYFPPVPTNAYPQAGHSVHSSNSWN
GAVRG*
Coding >AgabiH97|090740
ATGCCTCCATCGCCCTCCGCAACCGGCTCGCGGTCAGCTGTCGATGAAGACCTACAGAAACTTTACAACGATGTG
CTTGCCGGGTTTGATGCAGAAGTCCCGTCTCTCTCCTTGAACGATAATACAAGCCCTGGCTACATCTATGGCGAC
TACGGCGATGCATCTAACAATGAGAACAGAAACGGAGATGTTAACGCCCCAATTTCGCATCATAGCTACGACAAA
TACACTCCTACATCACCAACTAGTGTCTTGAGCCATTCATCTCAACTCTCCGATCCTCCCAACTTCTCTCGTCCT
GGAGCAGTGAGGAGACTCCCACCCACTCCAGGATCATCAAATACCGAATTTTCAGCCACTTCACCGTCAATGTCG
ATGCCGGACCCGGAGCCTTACTTCGACCCGTATGTTGCGTTCGTACCTCCTACCACTAAAAGAGCTCCCGTTTCT
TCAACTGGTCGACGTCTTCCCATTACCCCAGATCAAGCTTCAGTGGTAGCTTCTTCATATAATCGGCCGCCTCTA
CCAGGACTACCCTCCAGCCAACGCCCGTCTGCCTTTCATGTTCCGACTTACTCCAGCTCAAGCGTTCATGGTCCC
TACTCGCCTGAGAAGGCTCCCGACGGCCTTGAAGATGGTGAATCGGCTTTAGAACAGGTTTTGACCATGTCACCA
ACATTTCATGACTCGGAAAGCACTTTCCAACCCCCTCAAGTCAATGTTGATCATGCTGATAATGACACGAAAATT
GTTGACCATGGCCATCACTATAGCTACTCTCAACCAGTAGTTCAACCACGAGCCCCTTCTTACGGCCACTCTCCT
TCACGTTCATTTGTAACATCGCCTAGTTCTCAAAACAGGGAATATATGATGCCTCAGCCCGAGGTTGCTTCGCTC
GGGAGGTCGTCCTCGTTGACTCCATATGGCGATTCGCTGTCTGTTCGAAGTGTCAGTTCCTCTCATGTCCCACAA
CTTGGACAATCTTCTTCTAGCCGAAATCCTACCCCAAGCGTCGGGGAATCCTCGACGTATAAAGGCTCAAGAGTG
GACGTACCTCCGCGTACGCCTGAGGAGGACGATAGTTTTGTTGCCCCTCCCTCTCCTATGCAGGAGCAAACGTAT
GGTGAAGTTCGAGGTCCAAGCGAGGCTCTGCATACGCTGGCAGACTTTGAGAACCCAGGAACACATGACGTGCAG
GATCCAGTGGAGGACTACTGGGACGATGCAGAAGAAGATGGTGACCGGTTTATCAACTACTTCCTACTTTCACAT
ATTGCGGTTCAGTTACGGGATAAAATTCCGAGGGGAACTCACGTCAAAGGGAGTATTCCTTATCACCGTGGCTTC
ACAGGGAAAGACATTGTGTCTACTATCCAGGCTTTGATTCAACGCGACTTAGCTATCACTTATGGTATTTCGACG
AACGACAGGCGCGTCGCGTTGCAGGTCGCACGCAGCCTTCAAAATCAGCTTTTCTTTTTCGAAGTTGAATGGGGC
GGTCGTATCCTTCAGGACGGAGTAGAAGATGTTTTCATGTTCTATGATGAGCAAGATGGTGGATCTGACGCCATA
TTTGAAAAGGAAGAGCTGCCGACGGGTGTGGTGACGATGCTCACACGCTGCTATTCGCCAAGTTGCGCGGATAGT
GGGCTAGAAGGGCCGCCATGTTATTCCTACTCATGTCCCAAACGAGAACATGGACAGAAATCTGGTTTGAGCGTC
GTTTCTGCAGTCCTAGAATCACCTGTTGAGGAGAAAGATTCTTGGACCAAAGGAATTGACGAACAAGTACTTAGT
GCATTGCCAGAAAATGAAATCAGTCGACAATCGATCATACATCAACTGATTGGAAAAGAAGAGCAATATATTGCA
GACCTTGACACGGTTGAGACTATGTTTATTAAACCCCTCCGTGCTGCGAAACCGTCGGTATTGCCCGAAGTAGAG
GATTTCATCGAGGAGGTCTTTGGGAATATCCTTGACCTACGTGAATGCAATCGCCGGTTGTTGGAGGTTCTTTAT
GTTCGGCAACGAGAGCAAGGGCCGATCATTCAAAGAATTGGAGATGTCTTCTTAAATGCCGCCGTGGAGTTCAGG
CTAGCCTATCCGACATACATCGGCCATCATATGACTGCGGAGAAGAGGCTGAAGGAAGAGCAAGAGAATAATGGA
GCTTTCAAGTTCTTCCTTGAGGACTGTACAAGGAAGACGGGGCGGCAAGGTGAACCCATTCGGTTGGATCTCAAA
CATTTTTTAAATAGACCCTCGGACCACTTACAAAAATACCCTGTCCTGTTGGAAGCTATATTGGAGAAGACGGAA
GAAGAGAACCCAGACGCGGAATTTCTCAAAGAAGCCATATCCACCATCAAAAGTCTGCATAGTTTTGCACAGTTA
AAGACCTTCCAGACTGCGATGGGTAAGGGTGCGCCTGGAAAGTGGGAATGGCATGACGTGGTCTCACCAGAATTG
ATGAAGAGTTTACCCAAAAAAGAGGTCAAGCGGCAAGCAGTAATCTTCGAGTTAATAAAAGGAGAAATGGCCTAC
GTGAAGGATCTAGAAAATATCAGGCTCATGTATGTTGATCCTTTACGCTCCGCAAATCCCCCAATCATACCCGGG
AACCGCTTGGAACAATTTATTAATGACGTTTTCCACAACTACTGGGATATCTTTTCCCATCATCGTCGACTCATG
GAGAAGCTCCACGAGATTCAGCGAGAGCATCATCCTTGCGTGCAAAGTATCACCGCGGCAATGTTTGATGCTGCG
CTGAACTTCCGTGATGCCTATTTGGAGTATATTCCTCATTATCCCATCGGGGCATATAGAATTGATGATGAAATG
GCGAACAATCCCGCTTTTAAGGCTTTCATTGATCAACAAACTCGACACCCCGATGCTCACAGGTTGGACATGAAG
AACTTTATCAATCGACCGATTCCACGTCTTCTACGTTATGAGCTACTTCTCAAGGATATTATGCACAATTCTGCT
GAAGGACATGAAGATCATGCCGACATTCCGAATGTTATCGACGCCATTAAGTCTCTTGGAAAAGAGACGGAGCCT
GGTGTTCAGGATGCAAAAACCAAGGTTGAGTTGTGGAGGTATAATGCCAACTTGGTCTTCAAACACGGCGAAACC
TTTGATATGGACCTTCTAGATGAAAAGCGACAACTCGTACATTCTGGCAAGTTATTGCGCCAGCCCGATAGTGGC
CTTGAATGGAATGGATGGAGCGAGTTGTTTGTATTGCTCTTTGACAATTATCTGGTGTTGACAAAACAGAGGGAG
AAGGATGGTGTTATGAAATACAACGTTTATAAACGACCCATTCCTCTCGATCTCGTGACCCTTGTCAATTTTACA
GACCCTCCAACGCAGCGGAATGCAGGACTTCTTCGTGGTCTTCGTGGAGGAGAGCGAAATGAGCCACCGGCCTTC
AGCGCGTCACCAGATACATCCACAGATTCCAAGTTTGTATTTTCTATGACCTTGCACCACAATGGACGCGCAGGA
GGGACGTATATACTTTACGCGGAAACGTCTCAGTCCCGATCAGAATGGCAGGCAAAGCTTAATCATGCATTGGCG
ATGCACAAGGCCGTACAAGACAGCAACAAAGTGTTTGAAGTCGAGACTTTGAGTGCGGATACTTTCTCGATGCCT
TTATTGCCGACCGCTGCTTCTGGACCAGCCTGGAGCCAGGATAATGCGATTACGGGCAAGGTTACTTGTTCCGTG
CCTTTCAATACCGCTGATGGTCGCAGGCTCGTAGCTATTGGTTGTGCTGAAGGAGTGTGGATTGGATTTCGTCAT
GATCCGAGATCGTTGCGCCGTGTCCTTCATCTCAGGCAGGTGACACAGTGTGCTATGTTGGAAGAGTTTAGTATA
TTCTTGGTCCTTGCGGATAAATCATTATTTGCGTACCATCTAGAAGCTCTAGTACCATCTGCACCCAACTTGGCT
CATCAAAATGTTCCTCAGAAGCTCAATGGAAACAAAGATGTGCATTTCTTTAGCGTCGGAACTCTGCATGGCCGG
ACTTTGGTTGTTTACATGAAGAAGAAAAACTTGGACAGCATCTTCCGAGTATTGGAACCTGTGGGTGACAAGATA
AATGAACGTGTCAAGGCTCCGGTTGGCTTAGGTTCTCGACTTGGCTTCCGATCCACTAAATCGGAGTGGTTCCGC
GTTTATCGTGATTTCTTCTTACCGTCCGAATCTTATGATATGATATTCCTCAAAGCAAGGATCGCTATTCTATGT
GCAAAGGGTTTCGAAATTATGGACCTCAATGATTTCAATAGTGTTACAATTCCTCAACGAGAGGACCCTCGCTTG
AGTCACCTTGCTAAGAGATGTGAATCCTGCCGACCGCTGGGTATGTTCCGCTCGGCGGATGACGAGTTTCTCCTG
TGTTATGACGAGTTCGGTGTTTACGTTGACAAACACGGTGACCCCAGTCGTTCTGCTGGAACGATTGAGTGGGAA
GGAACTGCGGAACGTGTCGCTCTTCATCATCCCTACATTCTTTTATTCGACTCCCGGTTTATTGAAGTGCGACAT
GTTGAGACCGGACGGCTGGCTCAAATTATCCCCGGAAATGACATCCGTTGTATATGGGACGGTCGGGGCGTGAGC
ACGAACCTCTCTATACCCACTACTGTGAGCGAGGAGATGGCGCAAGAAGCTCAGGTTCATGCAGTGATGACAAAC
CCTGACCAAGGCCCTATGAGCGTCGGCAGGCCAAAAACCATCCCACAATGTGTGTTCGAACTCATTCCTACCATC
CCACTATACCCCCCTCCCCCTCCTCCCCCCAAGAATGAAATGAATTCAGCAATCGCTAATCCAATGGCTAACGGA
TCTTACTTTCCGCCCGTACCGACAAATGCATACCCTCAGGCTGGTCATTCTGTACATTCTTCGAATTCGTGGAAT
GGTGCTGTTCGTGGTTGA
Transcript >AgabiH97|090740
ATGCCTCCATCGCCCTCCGCAACCGGCTCGCGGTCAGCTGTCGATGAAGACCTACAGAAACTTTACAACGATGTG
CTTGCCGGGTTTGATGCAGAAGTCCCGTCTCTCTCCTTGAACGATAATACAAGCCCTGGCTACATCTATGGCGAC
TACGGCGATGCATCTAACAATGAGAACAGAAACGGAGATGTTAACGCCCCAATTTCGCATCATAGCTACGACAAA
TACACTCCTACATCACCAACTAGTGTCTTGAGCCATTCATCTCAACTCTCCGATCCTCCCAACTTCTCTCGTCCT
GGAGCAGTGAGGAGACTCCCACCCACTCCAGGATCATCAAATACCGAATTTTCAGCCACTTCACCGTCAATGTCG
ATGCCGGACCCGGAGCCTTACTTCGACCCGTATGTTGCGTTCGTACCTCCTACCACTAAAAGAGCTCCCGTTTCT
TCAACTGGTCGACGTCTTCCCATTACCCCAGATCAAGCTTCAGTGGTAGCTTCTTCATATAATCGGCCGCCTCTA
CCAGGACTACCCTCCAGCCAACGCCCGTCTGCCTTTCATGTTCCGACTTACTCCAGCTCAAGCGTTCATGGTCCC
TACTCGCCTGAGAAGGCTCCCGACGGCCTTGAAGATGGTGAATCGGCTTTAGAACAGGTTTTGACCATGTCACCA
ACATTTCATGACTCGGAAAGCACTTTCCAACCCCCTCAAGTCAATGTTGATCATGCTGATAATGACACGAAAATT
GTTGACCATGGCCATCACTATAGCTACTCTCAACCAGTAGTTCAACCACGAGCCCCTTCTTACGGCCACTCTCCT
TCACGTTCATTTGTAACATCGCCTAGTTCTCAAAACAGGGAATATATGATGCCTCAGCCCGAGGTTGCTTCGCTC
GGGAGGTCGTCCTCGTTGACTCCATATGGCGATTCGCTGTCTGTTCGAAGTGTCAGTTCCTCTCATGTCCCACAA
CTTGGACAATCTTCTTCTAGCCGAAATCCTACCCCAAGCGTCGGGGAATCCTCGACGTATAAAGGCTCAAGAGTG
GACGTACCTCCGCGTACGCCTGAGGAGGACGATAGTTTTGTTGCCCCTCCCTCTCCTATGCAGGAGCAAACGTAT
GGTGAAGTTCGAGGTCCAAGCGAGGCTCTGCATACGCTGGCAGACTTTGAGAACCCAGGAACACATGACGTGCAG
GATCCAGTGGAGGACTACTGGGACGATGCAGAAGAAGATGGTGACCGGTTTATCAACTACTTCCTACTTTCACAT
ATTGCGGTTCAGTTACGGGATAAAATTCCGAGGGGAACTCACGTCAAAGGGAGTATTCCTTATCACCGTGGCTTC
ACAGGGAAAGACATTGTGTCTACTATCCAGGCTTTGATTCAACGCGACTTAGCTATCACTTATGGTATTTCGACG
AACGACAGGCGCGTCGCGTTGCAGGTCGCACGCAGCCTTCAAAATCAGCTTTTCTTTTTCGAAGTTGAATGGGGC
GGTCGTATCCTTCAGGACGGAGTAGAAGATGTTTTCATGTTCTATGATGAGCAAGATGGTGGATCTGACGCCATA
TTTGAAAAGGAAGAGCTGCCGACGGGTGTGGTGACGATGCTCACACGCTGCTATTCGCCAAGTTGCGCGGATAGT
GGGCTAGAAGGGCCGCCATGTTATTCCTACTCATGTCCCAAACGAGAACATGGACAGAAATCTGGTTTGAGCGTC
GTTTCTGCAGTCCTAGAATCACCTGTTGAGGAGAAAGATTCTTGGACCAAAGGAATTGACGAACAAGTACTTAGT
GCATTGCCAGAAAATGAAATCAGTCGACAATCGATCATACATCAACTGATTGGAAAAGAAGAGCAATATATTGCA
GACCTTGACACGGTTGAGACTATGTTTATTAAACCCCTCCGTGCTGCGAAACCGTCGGTATTGCCCGAAGTAGAG
GATTTCATCGAGGAGGTCTTTGGGAATATCCTTGACCTACGTGAATGCAATCGCCGGTTGTTGGAGGTTCTTTAT
GTTCGGCAACGAGAGCAAGGGCCGATCATTCAAAGAATTGGAGATGTCTTCTTAAATGCCGCCGTGGAGTTCAGG
CTAGCCTATCCGACATACATCGGCCATCATATGACTGCGGAGAAGAGGCTGAAGGAAGAGCAAGAGAATAATGGA
GCTTTCAAGTTCTTCCTTGAGGACTGTACAAGGAAGACGGGGCGGCAAGGTGAACCCATTCGGTTGGATCTCAAA
CATTTTTTAAATAGACCCTCGGACCACTTACAAAAATACCCTGTCCTGTTGGAAGCTATATTGGAGAAGACGGAA
GAAGAGAACCCAGACGCGGAATTTCTCAAAGAAGCCATATCCACCATCAAAAGTCTGCATAGTTTTGCACAGTTA
AAGACCTTCCAGACTGCGATGGGTAAGGGTGCGCCTGGAAAGTGGGAATGGCATGACGTGGTCTCACCAGAATTG
ATGAAGAGTTTACCCAAAAAAGAGGTCAAGCGGCAAGCAGTAATCTTCGAGTTAATAAAAGGAGAAATGGCCTAC
GTGAAGGATCTAGAAAATATCAGGCTCATGTATGTTGATCCTTTACGCTCCGCAAATCCCCCAATCATACCCGGG
AACCGCTTGGAACAATTTATTAATGACGTTTTCCACAACTACTGGGATATCTTTTCCCATCATCGTCGACTCATG
GAGAAGCTCCACGAGATTCAGCGAGAGCATCATCCTTGCGTGCAAAGTATCACCGCGGCAATGTTTGATGCTGCG
CTGAACTTCCGTGATGCCTATTTGGAGTATATTCCTCATTATCCCATCGGGGCATATAGAATTGATGATGAAATG
GCGAACAATCCCGCTTTTAAGGCTTTCATTGATCAACAAACTCGACACCCCGATGCTCACAGGTTGGACATGAAG
AACTTTATCAATCGACCGATTCCACGTCTTCTACGTTATGAGCTACTTCTCAAGGATATTATGCACAATTCTGCT
GAAGGACATGAAGATCATGCCGACATTCCGAATGTTATCGACGCCATTAAGTCTCTTGGAAAAGAGACGGAGCCT
GGTGTTCAGGATGCAAAAACCAAGGTTGAGTTGTGGAGGTATAATGCCAACTTGGTCTTCAAACACGGCGAAACC
TTTGATATGGACCTTCTAGATGAAAAGCGACAACTCGTACATTCTGGCAAGTTATTGCGCCAGCCCGATAGTGGC
CTTGAATGGAATGGATGGAGCGAGTTGTTTGTATTGCTCTTTGACAATTATCTGGTGTTGACAAAACAGAGGGAG
AAGGATGGTGTTATGAAATACAACGTTTATAAACGACCCATTCCTCTCGATCTCGTGACCCTTGTCAATTTTACA
GACCCTCCAACGCAGCGGAATGCAGGACTTCTTCGTGGTCTTCGTGGAGGAGAGCGAAATGAGCCACCGGCCTTC
AGCGCGTCACCAGATACATCCACAGATTCCAAGTTTGTATTTTCTATGACCTTGCACCACAATGGACGCGCAGGA
GGGACGTATATACTTTACGCGGAAACGTCTCAGTCCCGATCAGAATGGCAGGCAAAGCTTAATCATGCATTGGCG
ATGCACAAGGCCGTACAAGACAGCAACAAAGTGTTTGAAGTCGAGACTTTGAGTGCGGATACTTTCTCGATGCCT
TTATTGCCGACCGCTGCTTCTGGACCAGCCTGGAGCCAGGATAATGCGATTACGGGCAAGGTTACTTGTTCCGTG
CCTTTCAATACCGCTGATGGTCGCAGGCTCGTAGCTATTGGTTGTGCTGAAGGAGTGTGGATTGGATTTCGTCAT
GATCCGAGATCGTTGCGCCGTGTCCTTCATCTCAGGCAGGTGACACAGTGTGCTATGTTGGAAGAGTTTAGTATA
TTCTTGGTCCTTGCGGATAAATCATTATTTGCGTACCATCTAGAAGCTCTAGTACCATCTGCACCCAACTTGGCT
CATCAAAATGTTCCTCAGAAGCTCAATGGAAACAAAGATGTGCATTTCTTTAGCGTCGGAACTCTGCATGGCCGG
ACTTTGGTTGTTTACATGAAGAAGAAAAACTTGGACAGCATCTTCCGAGTATTGGAACCTGTGGGTGACAAGATA
AATGAACGTGTCAAGGCTCCGGTTGGCTTAGGTTCTCGACTTGGCTTCCGATCCACTAAATCGGAGTGGTTCCGC
GTTTATCGTGATTTCTTCTTACCGTCCGAATCTTATGATATGATATTCCTCAAAGCAAGGATCGCTATTCTATGT
GCAAAGGGTTTCGAAATTATGGACCTCAATGATTTCAATAGTGTTACAATTCCTCAACGAGAGGACCCTCGCTTG
AGTCACCTTGCTAAGAGATGTGAATCCTGCCGACCGCTGGGTATGTTCCGCTCGGCGGATGACGAGTTTCTCCTG
TGTTATGACGAGTTCGGTGTTTACGTTGACAAACACGGTGACCCCAGTCGTTCTGCTGGAACGATTGAGTGGGAA
GGAACTGCGGAACGTGTCGCTCTTCATCATCCCTACATTCTTTTATTCGACTCCCGGTTTATTGAAGTGCGACAT
GTTGAGACCGGACGGCTGGCTCAAATTATCCCCGGAAATGACATCCGTTGTATATGGGACGGTCGGGGCGTGAGC
ACGAACCTCTCTATACCCACTACTGTGAGCGAGGAGATGGCGCAAGAAGCTCAGGTTCATGCAGTGATGACAAAC
CCTGACCAAGGCCCTATGAGCGTCGGCAGGCCAAAAACCATCCCACAATGTGTGTTCGAACTCATTCCTACCATC
CCACTATACCCCCCTCCCCCTCCTCCCCCCAAGAATGAAATGAATTCAGCAATCGCTAATCCAATGGCTAACGGA
TCTTACTTTCCGCCCGTACCGACAAATGCATACCCTCAGGCTGGTCATTCTGTACATTCTTCGAATTCGTGGAAT
GGTGCTGTTCGTGGTTGA
Gene >AgabiH97|090740
ATGCCTCCATCGCCCTCCGCAACCGGCTCGCGGTCAGCTGTCGATGAAGACCTACAGAAACTTTACAACGATGTG
CTTGCCGGGTTTGATGCAGAAGTCCCGTCTCTCTCCTTGAACGATAATACAAGCCCTGGCTACATCTATGGCGAC
TACGGCGATGCATCTAACAATGAGAACAGAAACGGAGATGTTAACGCCCCAATTTCGCATCATAGCTACGACAAA
TACACTCCTACATCACCAACTAGTGTCTTGAGCCGTATGTTGTAATTCATCGTCCACCGACTTCCAGCTCATATT
ACCCCAGATTCATCTCAACTCTCCGATCCTCCCAACTTCTCTCGTCCTGGAGCAGTGAGGAGACTCCCACCCACT
CCAGGATCATCAAATACCGAATTTTCAGCCACTTCACCGTCAATGTCGATGCCGGACCCGGAGCCTTACTTCGAC
CCGTATGTTGCGTTCGTACCTCCTACCACTAAAAGAGCTCCCGTTTCTTCAACTGGTCGACGTCTTCCCATTACC
CCAGATCAAGCTTCAGTGGTAGCTTCTTCATATAATCGGCCGCCTCTACCAGGACTACCCTCCAGCCAACGCCCG
TCTGCCTTTCATGTTCCGACTTACTCCAGCTCAAGCGTTCATGGTCCCTACTCGCCTGAGAAGGCTCCCGACGGC
CTTGAAGATGGTGAATCGGCTTTAGAACAGGTTTTGACCATGTCACCAACATTTCATGACTCGGAAAGCACTTTC
CAACCCCCTCAAGTCAATGTTGATCATGCTGATAATGACACGAAAATTGTTGACCATGGCCATCACTATAGCTAC
TCTCAACCAGTAGTTCAACCACGAGCCCCTTCTTACGGCCACTCTCCTTCACGTTCATTTGTAACATCGCCTAGT
TCTCAAAACAGGGAATATATGATGCCTCAGCCCGAGGTTGCTTCGCTCGGGAGGTCGTCCTCGTTGACTCCATGT
GAGCGTGTAAACTTTATATCTGTGACGTTGACTCATATTATACCAGATGGCGATTCGCTGTCTGTTCGAAGTGTC
AGTTCCTCTCATGTCCCACAACTTGGACAATCTTCTTCTAGCCGAAATCCTACCCCAAGCGTCGGGGAATCCTCG
ACGTATAAAGGCTCAAGAGTGGACGTACCTCCGCGTACGCCTGAGGAGGACGATAGTTTTGTTGCCCCTCCCTCT
CCTATGCAGGAGCAAACGTATGGTGAAGTTCGAGGTCCAAGCGAGGCTCTGCATACGCTGGCAGACTTTGAGAAC
CCAGGAACACATGACGTGCAGGATCCAGTGGAGGACTACTGGGACGATGCAGAAGAAGATGGTGACCGGTTTATC
AACTACTTCCTACTTTCACATATTGCGGTTCAGTTACGGGATAAAATTCCGAGGGGAACTCACGTCAAAGGGAGT
ATTCCTTATCACCGTGGCTTCACAGGGAAAGACATTGTGGTAAGGATTAGTTATGTTGTTGTGTATTCACCTTCT
GATGTTAATTTGACCTATCTTATATATAGTCTACTATCCAGGCTTTGATTCAACGCGACTTAGCTATCACTTATG
GTATTTCGACGAACGACAGGCGCGTCGCGTTGCAGGTCGCACGCAGCCTTCAAAATCAGCTTTTCTTTTTCGAAG
TTGAATGGGGCGGTCGTATCCTTCAGGACGGAGTAGAAGATGTTTTCATGTTCTATGATGAGCAAGATGGTGGAT
CTGACGCCATATTTGAAAAGGAAGAGCTGCCGACGGGTGTGGTGACGATGCTCACACGCTGCTATTCGCCAAGTT
GCGCGGATAGTGGGCTAGAAGGGCCGCCATGTTATTCCTACTCATGTCCCAAACGAGTAAGTTGTGAGTTCGCAC
TATATGATCCTTCACTGAGGCTTTGTACAGGAACATGGACAGAAATCTGGTTTGAGCGTCGTTTCTGCAGTCCTA
GAATCACCTGTTGAGGAGAAAGATTCTTGGACCAAAGGAATTGACGAACAAGTACTTAGTGCATTGCCAGAAAAT
GAAATCAGTCGACAATCGTAAGTGGGCCGTTATTCTGCGAATAAAAATCTTTTCAATGCTTTTGTAAAGGATCAT
ACATCAACTGATTGGAAAAGAAGAGCAATATATTGCAGACCTTGACACGGTTGAGACTATGTTTATTAAACCCCT
CCGTGCTGCGAAACCGTCGGTATTGCCCGAAGTAGAGGATTTCATCGAGGAGGTCTTTGGGAATATCCTTGACCT
ACGTGAATGCAATCGCCGGTTGTTGGAGGTTCTTTATGTTCGGCAACGAGAGCAAGGGCCGATCATTCAAAGAAT
TGGAGATGTCTTCTTAAATGCCGCCGTGGAGTTCAGGCTAGCCTATCCGACATACATCGGCCATCATATGACTGC
GGAGAAGAGGCTGAAGGAAGAGCAAGAGAATAATGGAGCTTTCAAGTTCTTCCTTGAGGTACATTTCGATAAAGC
AACGCTGCCTTCAATCAACTCATGTATAACGTAGGACTGTACAAGGAAGACGGGGCGGCAAGGTGAACCCATTCG
GTTGGATCTCAAACATTTTTTAAATAGACCCTCGGACCACTTACAAAAATACCCTGTCCTGTTGGAAGCTATATT
GGAGAAGACGGAAGAAGAGAACCCAGACGCGGAATTTCTCAAAGAAGCCATATCCACCATCAAAAGTCTGCATAG
TTTTGCACAGTTAAAGACCTTCCAGACTGCGATGGGTAAGGGTGCGCCTGGAAAGTGGGAATGGCATGACGTGGT
CTCACCAGAATTGATGAAGAGTTTACCCAAAAAAGAGGTCAAGCGGCAAGCGTGAGTGATCTTCGGTTATGAGGT
TGTCGGGTAGCTAAACGTGATAAAAACTTTCAGAGTAATCTTCGAGTTAATAAAAGGAGAAATGGCCTACGTGAA
GGATCTAGAAAATATCAGGCTCGTATGTACCTAAGAAAAATAAGCTCAAAGCACTTGACTGATCGCTATTGTAGA
TGTATGTTGATCCTTTACGCTCCGCAAATCCCCCAATCATACCCGGGAACCGCTTGGAACAATTTATTAATGACG
TTTTCCACAACTACTGGGATATCTTTTCCCATCATCGTCGACTCATGGAGAAGCTCCACGAGATTCAGCGAGAGC
ATCATCCTTGCGTGCAAAGTATCACCGCGGCAATGTTTGATGCTGCGCTGAACTTCCGTGATGCCTATTTGGAGT
ATATTCCTCATTATCCCATCGGGGCATATAGAATTGATGATGAAATGGCGAACAATCCCGCTTTTAAGGCTTTCA
TTGATGTAAGGATGATAGTTTCATTGGATATCATAACACCCTGTTCTTATGATATTACTTTTTTTAAAGCAACAA
ACTCGACACCCCGATGCTCACAGGTTGGACATGAAGAACTTTATCAATCGACCGATTCCACGTCTTCTACGTTAT
GAGCTACTTCTCAAGGATATTATGCACAATTCTGCTGAAGGACATGAAGATCATGCCGACATTCCGAATGTTATC
GACGCCATTAAGTCTCTTGGAAAAGAGACGGAGCCTGGTGTTCAGGATGCAAAAACCAAGGTTGAGTTGTGGAGG
TATAATGCCAACTTGGTCTTCAAACACGGCGAAACCTTTGTGAGTTTCGGTGTTTGATTTGACTATATTTTTAGC
AGGTTATTAACCCAGAGTTATGAAGGATATGGACCTTCTAGATGAAAAGCGACAACTCGTACATTCTGGCAAGTT
ATTGCGCCAGCCCGATAGTGGCCTTGAATGGAATGGATGGAGCGAGTTGTTTGTATTGCTCTTTGACAATTATCG
TGAGTTTGATCTCGTGTCTGTGGTCATATTGGCTTATGTTCCTTTCAATTGTTCTAAGTGGTGTTGACAAAACAG
AGGGAGAAGGATGGTGTTATGAAATACAACGTTTATAAACGACCCATTCCTCTCGATCTCGTGACCCTTGTCAAT
TTTACAGACCCTCCAACGCAGCGGAATGCAGGACTTCTTCGTGGTCTTCGTGGAGGAGAGCGAAATGAGCCACCG
GCCTTCAGCGCGTCACCAGATACATCCACAGATTCCAAGTTTGTATTTTCTATGACCTTGCACCACAATGGACGC
GCAGGAGGGACGTATATACTTTACGCGGAAACGTCTCAGTCCCGATCAGAATGGCAGGCAAAGCTTAATCATGCA
TTGGCGATGCACAAGGCCGTACAAGACAGCAACAAAGTGTTTGAAGTCGAGACTTTGAGTGCGGATACTTTCTCG
ATGCCTTTATTGCCGACCGCTGCTTCTGGACCAGCCTGGAGCCAGGATAATGCGATTACGGGCAAGGTTACTTGT
TCCGTGCCTTTCAGTGAGTCTATGACTTTCAGTTTGATGTTGTGTTAAATTGCTTTTAGATACCGCTGATGGTCG
CAGGCTCGTAGCTATTGGTTGTGCTGAAGGAGTGTGGATTGGATTTCGTCATGATCCGAGATGTAAGCCATTTGC
GCCCCGATCTAAGATTCGTATTAAATCTTGCAATTAGCGTTGCGCCGTGTCCTTCATCTCAGGCAGGTGACACAG
TGTGCTATGTTGGAAGAGTTTAGTATATTCTTGGTCCTTGCGGATAAAGTAAGTTTATTCAATGCTGACGTTGTG
CTTATTGCTGAATTTATTGTAGTCATTATTTGCGTACCATCTAGAAGCTCTAGTACCATCTGCACCCAACTTGGC
TCATCAAAATGTTCCTCAGAAGCTCAATGGAAACAAAGATGTGCATTTCTTTAGCGTCGGAACTCTGCATGGCCG
GACTTTGGTTGTTTACATGAAGAAGAAAAACGTAGGAGTAGATTCTTATCAGGAGATGTTCACACACTGATTTCG
TACTAGTTGGACAGCATCTTCCGAGTATTGGAACCTGTGGGTGACAAGATAAATGAACGTGTCAAGGCTCCGGTT
GGCTTAGGTTCTCGACTTGGCTTCCGATCCACTAAATCGGAGTGGTTCCGCGTTTATCGTGATTTCTTCTTACCG
TCCGAATCTTATGATATGATATTCCTCAAAGCAAGGATCGCTATTCTATGTGCAAAGGGTTTCGAAATTATGGAC
CTCAATGAGTAAGTGATTCCCGAGTAAACCTCTGCAAGTTTGCTAACTCTGTAATCAGTTTCAATAGTGTTACAA
TTCCTCAACGAGAGGACCCTCGCTTGAGTCACCTTGCTAAGAGATGTGAATCCTGCCGACCGCTGGGTATGTTCC
GCTCGGCGGATGACGAGTTTCTCCTGTGTTATGACGGTAAATACAGTCAAAGCATTTCCCTAGCAATGGTTGATT
CACATTGATGTAGAGTTCGGTGTTTACGTTGACAAACACGGTGACCCCAGTCGTTCTGCTGGAACGATTGAGTGG
GAAGGAACTGCGGAACGTGTCGCTCTTCATCATCCCTACATTCTTTTATTCGACTCCCGGTTTATTGAAGTGCGA
CATGTTGAGACCGGACGGCTGGCTCAAATTATCCCCGGAAATGACATCCGTTGTATATGGGACGGTCGGGGCGTG
AGCACGAACCTCTCTATACCCACTACTGTGAGCGAGGAGATGGCGCAAGAAGCTCAGGTTCATGCAGTGATGACA
AACCCTGACCAAGGCCCTATGAGCGTCGGCAGGCCAAAAACCATCCCACAATGTGTGTTCGAACTCATTCCTACC
ATCCCACTATACCCCCCTCCCCCTCCTCCCCCCAAGAATGAAATGAATTCAGCAATCGCTAATCCAATGGCTAAC
GGATCTTACTTTCCGCCCGTACCGACAAATGCATACCCTCAGGCTGGTCATTCTGTACATTCTTCGAATTCGTGG
AATGGTGCTGTTCGTGGTTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail