Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090720
Gene name
Locationscaffold_6:641989..644293
Strand+
Gene length (bp)2304
Transcript length (bp)1770
Coding sequence length (bp)1770
Protein length (aa) 590

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Cytoplasm 0.5551 0.3786 0.3151 0.0662 0.2235 0.0844 0.1927 0.1397 0.274 0.0398

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup4641
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|090720
Agaricus bisporus var bisporus H97 AgabiH97|090720 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|20_14

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090720
MSGRGPVYSLKHRDKNKSISMSKNYPGSGESGVLFNKISADFVLCDDTFRKWDNCGYQGKRRGEIGSKMEDIANK
SSGIRSSLSTVTCSGLRCILTYPNIMGLLSPGSISTIGPQTISPRPFAIILSPLRLVCREYRLLTKTRSLWFAYI
QRYFLRHNISIPGLHGRPLETLDAQELETLTLKAERYKRNWLSGAQSPKPTRHVEFIAVPDSRIIALKFLSRNGE
NWLFSLAMTRNHGMRAFTFQCWDLKLNPPVCIARRILHHFAGMAFNKLETGRAVVAVKTPEICLIDIDTGGAAGG
EPSGKRASVGDSNSTRHPAQACVNVANLDDRAVGTLMLLGDLVLAQDNAGRSFLYHFESPQIRVQLIDPEGNAQP
EIILDVLVDRGWLILARTKTVELYQLPASIDHNTQIEPIARHTWQWKVDSIVLAPLVNNTKNSTTPIQIVIRYGS
IHPWPVNMMHRFMLRPNTDFDSSLPASRSNNPYVFPLVSAQSIGSPIRLMATYDMAVGSYGTIVYFDSHTEDYFG
HSDFGQRLAGMRIPGEGKAGEVVPESSVYKVIERDEWTRVALQEEEGKIAVGHVDGKITLLDYA*
Coding >AgabiH97|090720
ATGTCCGGCAGAGGCCCTGTTTACTCTCTGAAACATAGGGACAAAAACAAATCGATTTCCATGTCCAAAAACTAT
CCCGGATCTGGAGAATCTGGTGTGTTATTCAACAAAATATCCGCTGATTTCGTGCTATGCGATGACACATTTCGG
AAATGGGATAACTGTGGGTACCAAGGAAAACGCCGTGGTGAAATTGGCTCCAAAATGGAGGATATCGCGAACAAA
TCAAGCGGAATTAGATCTTCTCTCTCGACGGTGACCTGCAGTGGTCTCAGGTGCATTCTTACCTATCCAAACATC
ATGGGTTTACTTTCTCCTGGAAGTATTAGCACGATCGGGCCTCAGACAATATCCCCTCGACCCTTTGCTATTATT
CTCTCTCCTCTGAGACTGGTCTGCAGAGAATACCGACTTCTGACGAAAACTCGCTCACTCTGGTTTGCTTATATC
CAACGATATTTCCTTCGTCATAATATCTCTATTCCCGGTCTTCATGGTCGACCTCTCGAGACACTCGATGCCCAG
GAACTAGAGACACTCACGCTTAAAGCCGAGAGGTACAAAAGAAACTGGCTCTCAGGGGCACAGTCACCTAAACCG
ACACGACATGTCGAATTCATTGCTGTCCCAGATTCTCGTATAATCGCATTAAAATTTCTTTCTCGCAATGGCGAG
AATTGGCTCTTCTCTTTGGCTATGACACGAAATCATGGCATGCGTGCATTTACCTTCCAGTGTTGGGATCTAAAA
CTTAACCCCCCTGTCTGCATTGCTCGCCGTATTCTTCATCACTTTGCTGGTATGGCATTCAATAAATTGGAAACG
GGCCGAGCTGTAGTTGCTGTAAAGACTCCAGAAATATGTTTGATCGATATTGATACGGGGGGTGCTGCAGGAGGC
GAACCAAGTGGGAAACGGGCTAGTGTCGGCGATTCCAATTCGACGAGACACCCTGCGCAAGCTTGTGTCAATGTC
GCAAATCTAGATGATAGGGCTGTTGGGACTTTGATGCTACTCGGGGATTTGGTGCTGGCACAAGACAATGCAGGG
CGAAGTTTCCTATACCACTTCGAATCACCGCAGATACGGGTCCAGTTGATTGACCCGGAAGGGAATGCACAGCCT
GAAATAATCTTGGATGTTCTGGTGGACCGTGGTTGGCTTATCTTGGCCAGAACCAAGACCGTGGAGCTGTATCAG
CTCCCTGCTTCCATAGACCACAATACTCAGATCGAACCTATCGCGCGACATACATGGCAATGGAAAGTGGACTCG
ATAGTCCTTGCTCCTCTGGTGAATAATACGAAGAACTCCACTACGCCTATACAAATTGTAATACGGTATGGAAGC
ATCCATCCATGGCCAGTCAATATGATGCATCGTTTCATGCTTCGTCCAAATACCGATTTCGATTCAAGCCTACCA
GCAAGTAGATCAAATAACCCTTATGTTTTTCCTCTGGTCAGCGCTCAGTCAATCGGTTCACCTATCCGACTTATG
GCAACATATGACATGGCCGTTGGTTCCTATGGGACAATAGTCTATTTTGATAGTCACACGGAGGACTATTTTGGA
CACAGTGATTTTGGTCAGAGACTAGCAGGTATGAGGATACCCGGGGAAGGAAAGGCTGGAGAGGTGGTTCCAGAA
TCATCCGTCTACAAGGTCATTGAACGGGATGAATGGACTAGAGTTGCCTTGCAGGAAGAGGAGGGTAAAATTGCT
GTTGGACATGTGGATGGAAAAATCACGCTTCTAGATTATGCCTAG
Transcript >AgabiH97|090720
ATGTCCGGCAGAGGCCCTGTTTACTCTCTGAAACATAGGGACAAAAACAAATCGATTTCCATGTCCAAAAACTAT
CCCGGATCTGGAGAATCTGGTGTGTTATTCAACAAAATATCCGCTGATTTCGTGCTATGCGATGACACATTTCGG
AAATGGGATAACTGTGGGTACCAAGGAAAACGCCGTGGTGAAATTGGCTCCAAAATGGAGGATATCGCGAACAAA
TCAAGCGGAATTAGATCTTCTCTCTCGACGGTGACCTGCAGTGGTCTCAGGTGCATTCTTACCTATCCAAACATC
ATGGGTTTACTTTCTCCTGGAAGTATTAGCACGATCGGGCCTCAGACAATATCCCCTCGACCCTTTGCTATTATT
CTCTCTCCTCTGAGACTGGTCTGCAGAGAATACCGACTTCTGACGAAAACTCGCTCACTCTGGTTTGCTTATATC
CAACGATATTTCCTTCGTCATAATATCTCTATTCCCGGTCTTCATGGTCGACCTCTCGAGACACTCGATGCCCAG
GAACTAGAGACACTCACGCTTAAAGCCGAGAGGTACAAAAGAAACTGGCTCTCAGGGGCACAGTCACCTAAACCG
ACACGACATGTCGAATTCATTGCTGTCCCAGATTCTCGTATAATCGCATTAAAATTTCTTTCTCGCAATGGCGAG
AATTGGCTCTTCTCTTTGGCTATGACACGAAATCATGGCATGCGTGCATTTACCTTCCAGTGTTGGGATCTAAAA
CTTAACCCCCCTGTCTGCATTGCTCGCCGTATTCTTCATCACTTTGCTGGTATGGCATTCAATAAATTGGAAACG
GGCCGAGCTGTAGTTGCTGTAAAGACTCCAGAAATATGTTTGATCGATATTGATACGGGGGGTGCTGCAGGAGGC
GAACCAAGTGGGAAACGGGCTAGTGTCGGCGATTCCAATTCGACGAGACACCCTGCGCAAGCTTGTGTCAATGTC
GCAAATCTAGATGATAGGGCTGTTGGGACTTTGATGCTACTCGGGGATTTGGTGCTGGCACAAGACAATGCAGGG
CGAAGTTTCCTATACCACTTCGAATCACCGCAGATACGGGTCCAGTTGATTGACCCGGAAGGGAATGCACAGCCT
GAAATAATCTTGGATGTTCTGGTGGACCGTGGTTGGCTTATCTTGGCCAGAACCAAGACCGTGGAGCTGTATCAG
CTCCCTGCTTCCATAGACCACAATACTCAGATCGAACCTATCGCGCGACATACATGGCAATGGAAAGTGGACTCG
ATAGTCCTTGCTCCTCTGGTGAATAATACGAAGAACTCCACTACGCCTATACAAATTGTAATACGGTATGGAAGC
ATCCATCCATGGCCAGTCAATATGATGCATCGTTTCATGCTTCGTCCAAATACCGATTTCGATTCAAGCCTACCA
GCAAGTAGATCAAATAACCCTTATGTTTTTCCTCTGGTCAGCGCTCAGTCAATCGGTTCACCTATCCGACTTATG
GCAACATATGACATGGCCGTTGGTTCCTATGGGACAATAGTCTATTTTGATAGTCACACGGAGGACTATTTTGGA
CACAGTGATTTTGGTCAGAGACTAGCAGGTATGAGGATACCCGGGGAAGGAAAGGCTGGAGAGGTGGTTCCAGAA
TCATCCGTCTACAAGGTCATTGAACGGGATGAATGGACTAGAGTTGCCTTGCAGGAAGAGGAGGGTAAAATTGCT
GTTGGACATGTGGATGGAAAAATCACGCTTCTAGATTATGCCTAG
Gene >AgabiH97|090720
ATGTCCGGCAGAGGCCCTGTTTACTCTCTGAAACATAGTAGGAATAAGATAATCCTTACGGAAAATCACCCACTA
TTTATGTAACTGGTATTCATTTGCAGGGGACAAAAACAAATCGATTTCCATGTTGGCGGGCCACTGACGAAAAAT
GGAAGGTGCGATTTTGTCGAAGCGTCCAGGTCCAAAAACTATCCCGGATCTGGAGAATCTGGTGTGTTATTCAAC
AAAATATCCGCTGATTTCGTGCTATGCGATGACACATTTCGGAAATGGGATAACTGTGGGTACCAAGGAAAACGC
CGTGGTGAAATTGGCTCCAAAATGGAGGATATCGCGAACAAATCAAGCGGAATTAGATCTTCTCTCTCGACGGTG
ACCTGCAGTGGTCTCAGGTGCATTCTTACCTATCCAAACATCATGGGTTTACTTTCTCCTGGAAGTATTAGCACG
ATCGGGTAAGTCATCGTGACAAAGATGATCGACGTAGTTGGGGAACGGGCATAACTTATGTTCCTATTTAATGAA
TAGGCCTCAGACAATATCCCCTCGACCCTTTGCTATTATTCTCTCTCCTCGTGGCTTGTTGTCCTCGGTGAAGGA
TGGCCTTTCTTCCGCTCGATATTCTCCCTATCATACTCTCCCATCTTACGATACCTGACATATACCGAGTGAGAC
TGGTAAGCAACACGCTTCTTCATCGCAGCGGTAGTCCCATCATTGATACTTAGCATTGACTAGGTCTGCAGAGAA
TACCGACTTCTGACGAAAACTCGCTCACTCTGGTTTGCTTATATCCAACGATATTTCCTTCGTCATAATATCTCT
ATTCCCGGTCTTCATGGTCGACCTCTCGAGACACTCGATGCCCAGGAACTAGAGACACTCACGCTTAAAGCCGAG
AGGTACAAAAGAAACTGGCTCTCAGGGGCACAGTCACCTAAACCGACACGACATGTCGAATTCATTGCTGTCCCA
GATTCTCGTATAATCGCATTAAAATTTCTTTCTCGCAATGGCGAGAATTGGCTCTTCTCTTTGGCTATGACACGA
AATCATGGCATGCGTGCATTTACCTTCCAGTGTTGGGATCTAAAACTTAACCCCCCTGTCTGCATTGCTCGCCGT
ATTCTTCATCACTTTGCTGGTATGGCATTCAATAAATTGGAAACGGGCCGAGCTGTAGTTGCTGTAAAGACTCCA
GAGTGCGTTGGATTCTTTCCATCGTGTTGCCTCGGAGCCTTGACGTGCCCTGGCGTCCTTCTCAGAATATGTTTG
ATCGATATTGATACGGGGGGTGCTGCAGGAGGCGAACCAAGTGGGAAACGGGCTAGTGTCGGCGATTCCAATTCG
ACGAGACACCCTGCGCAAGCTTGTGTCAATGTCGCAAATCTAGATGATAGGGCTGTTGGGACTTTGATGCTACTC
GGGGATTTGGTGCTGGCACAAGACAATGCAGGGCGAAGTTTCCTATACCACTTCGAATCACCGCAGATACGGGTC
CAGTTGATTGACCCGGAAGGGAATGCACAGGTATTTTTTGCTTCTATTATGCTTCTGATTCGTTTCACTGACTTA
TTTGATGATGCTATTGATATGTAATAGCCTGAAATAATCTTGGATGTTCTGGTGGACCGTGGTTGGCTTATCTTG
GCCAGAACCAAGACCGTGGAGCTGTATCAGCTCCCTGCTTCCATAGACCACAATACTCAGATCGAACCTATCGCG
CGACATACATGGCAATGGAAAGTGGACTCGATAGTCCTTGCTCCTCTGGTGAATAATACGAAGAACTCCACTACG
CCTATACAAATTGTAATACGGTATGGAAGCATCCATCCATGGGTAAATTATATTTTGATTTATATATATTCAAAT
TCACTGAAGTACTGCTTTCAGCCAGTCAATATGATGCATCGTTTCATGCTTCGTCCAAATACCGATTTCGATTCA
AGCCTACCAGCAAGTAGATCAAATAACCCTTATGTTTTTCCTCTGGTCAGCGCTCAGTCAATCGGTTCACCTATC
CGACTTATGGCAACATATGACATGGCCGTTGGTTCCTATGGGACAATAGTCTATTTTGATAGTCACACGGAGGAC
TATTTTGGACACAGTGATTTTGGTCAGAGACTAGCAGGTATGAGGATACCCGGGGAAGGAAAGGCTGGAGAGGTG
GTTCCAGAATCATCCGTCTACAAGGTCATTGAACGGGATGAATGGACTAGAGTTGCCTTGCAGGAAGAGGAGGGT
AAAATTGCTGTTGGACATGTGGATGGAAAAATCACGCTTCTAGATTATGCCTAG

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail