Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090620
Gene name
Locationscaffold_6:609031..610076
Strand-
Gene length (bp)1045
Transcript length (bp)783
Coding sequence length (bp)783
Protein length (aa) 261

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 8.0E-11 28 113

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 7 181 3.0E-17
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 1 185 6.0E-17
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 18 234 4.0E-11
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 111 5.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 26 111 5.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 7 181 3.0E-17
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 1 185 6.0E-17
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 18 234 4.0E-11
sp|Q86IA3|PDI1_DICDI Protein disulfide-isomerase 1 OS=Dictyostelium discoideum GN=pdi1 PE=1 SV=2 1 111 5.0E-09
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 26 111 5.0E-08
sp|P80284|PDI_HORVU Protein disulfide-isomerase OS=Hordeum vulgare GN=PDI PE=1 SV=2 28 133 3.0E-07
sp|P29828|PDI_MEDSA Protein disulfide-isomerase OS=Medicago sativa GN=PDI PE=2 SV=1 24 149 3.0E-07
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 23 146 4.0E-07
sp|P52589|PDI_WHEAT Protein disulfide-isomerase OS=Triticum aestivum GN=PDI PE=2 SV=1 28 133 5.0E-07
sp|Q53LQ0|PDI11_ORYSJ Protein disulfide isomerase-like 1-1 OS=Oryza sativa subsp. japonica GN=PDIL1-1 PE=2 SV=1 28 133 6.0E-07
sp|Q54EN4|PDI2_DICDI Protein disulfide-isomerase 2 OS=Dictyostelium discoideum GN=pdi2 PE=3 SV=1 26 232 1.0E-06
sp|P38658|ERP60_SCHMA Probable protein disulfide-isomerase ER-60 OS=Schistosoma mansoni PE=3 SV=1 3 176 6.0E-06
sp|Q75M08|PDI21_ORYSJ Protein disulfide isomerase-like 2-1 OS=Oryza sativa subsp. japonica GN=PDIL2-1 PE=2 SV=2 28 254 8.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 20 0.45

Transmembrane Domains

Domain # Start End Length
1 7 29 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090620
MKLLSQLFVLALAPSLAFGSLFSASSHVQMLDSKSFKKAMKTNQTSLVVYVTTSSGHCRHMAAEMDQASEKLHPL
IPTYAVDCDNEKNKALCAEEWVQKLPTVTLFPRGNTLTPTICPERKAAGVVKWTSSHIPDYVTQLSNIDDIESWK
EKTKEETTLLLLTKEKKVPLLWRVLANKYSGRLELAAHWDEHGQAANDLGLDSNTKVLIYPAGDSKPVKYEGTTK
YEPLTKFFDSILDGTADVGTASEGQKLSDRPDDEL*
Coding >AgabiH97|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCCCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATCAAACTAGCTTGGTAGTCTAT
GTGACCACCTCTAGCGGACATTGTCGACATATGGCTGCGGAAATGGATCAAGCTTCTGAAAAATTACACCCCCTC
ATTCCTACCTATGCTGTTGATTGCGACAACGAAAAGAATAAAGCTTTGTGTGCAGAAGAATGGGTGCAGAAACTT
CCTACTGTGACGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCGGCTGGAGTT
GTTAAATGGACGTCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAGTCATGGAAA
GAAAAGACGAAGGAGGAAACCACACTTCTTCTTCTGACAAAAGAGAAAAAAGTCCCGCTACTTTGGAGAGTTCTT
GCCAACAAATATTCCGGAAGGCTCGAGTTAGCCGCCCATTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGA
CTTGACAGCAATACCAAAGTTCTCATATACCCCGCCGGTGATTCAAAACCTGTCAAATATGAGGGCACCACCAAA
TACGAGCCTTTGACAAAGTTCTTTGATTCAATCCTCGACGGTACAGCCGACGTCGGGACAGCAAGCGAGGGGCAG
AAGTTATCCGACCGTCCGGACGATGAACTATAA
Transcript >AgabiH97|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCCCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATCAAACTAGCTTGGTAGTCTAT
GTGACCACCTCTAGCGGACATTGTCGACATATGGCTGCGGAAATGGATCAAGCTTCTGAAAAATTACACCCCCTC
ATTCCTACCTATGCTGTTGATTGCGACAACGAAAAGAATAAAGCTTTGTGTGCAGAAGAATGGGTGCAGAAACTT
CCTACTGTGACGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCGGCTGGAGTT
GTTAAATGGACGTCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAGTCATGGAAA
GAAAAGACGAAGGAGGAAACCACACTTCTTCTTCTGACAAAAGAGAAAAAAGTCCCGCTACTTTGGAGAGTTCTT
GCCAACAAATATTCCGGAAGGCTCGAGTTAGCCGCCCATTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGA
CTTGACAGCAATACCAAAGTTCTCATATACCCCGCCGGTGATTCAAAACCTGTCAAATATGAGGGCACCACCAAA
TACGAGCCTTTGACAAAGTTCTTTGATTCAATCCTCGACGGTACAGCCGACGTCGGGACAGCAAGCGAGGGGCAG
AAGTTATCCGACCGTCCGGACGATGAACTATAA
Gene >AgabiH97|090620
ATGAAATTATTATCGCAATTATTCGTGCTGGCTCTGGCCCCTTCTTTAGCGTTCGGTTCCCTGTTTTCCGCTAGC
TCCCATGTGCAGATGCTGGATTCAAAGTCATTTAAGAAGGCGATGAAAACTAATGTGAATGCTTTAATTATCTAC
GTGACCGTTCCAATGCTGACATCTTATCATAGCAAACTAGCTTGGTAGTCTATGTGACCACCTCTAGCGGAGTGA
GCTTTAGGTCTCTTTTTTAGAACAACGGACTAATCATTCCAACAGCATTGTCGACATATGGCTGCGGAAATGGAT
CAAGCTTCTGAAAAATTACACCCCCTCATTCCTACCTATGCTGTTGATTGCGACAACGAAAAGAATAAAGCTTTG
TGTGCAGAAGAATGGGTGCAGAAACTTCCTACTGTGACGGTTTGAATTATGTTTTACGCCTCATTGACGCGCCCG
TGGTCTTATGCTCATTTGTAGCTGTTCCCTCGCGGAAATACACTTACGCCCACGATTTGTCCGGAACGCAAGGCG
GCTGGAGTTGTTAAATGGACGTCGTCACATATTCCCGATTATGTGACCCAGCTTTCAAACATTGACGACATCGAG
TCATGGAAAGAAAAGGCTAGTAGTATCTTTGCCTTTGACGCCGCGACACTCATGGTTTATTTGTAGACGAAGGAG
GAAACCACACTTCTTCTTCTGACAAAAGAGAAAAAAGTCCCGCTACTTTGGAGAGTTCTTGCCAACAAATATTCC
GGAAGGCTCGAGTTAGCCGCCCATTGGGATGAGCACGGACAAGCGGCCAACGATCTCGGACTTGACAGCAATACC
AAAGTTCTCATATACCCCGCCGGTGATTCAAAACCTGTCAAATATGAGGGTATGTTGGCGTTTTCTAATGTTAAA
TTGTACCCGTGGTGACGACTTTACAGGCACCACCAAATACGAGCCTTTGACAAAGTTCTTTGATTCAATCCTCGA
CGGTACAGCCGACGTCGGGACAGCAAGCGAGGGGCAGAAGTTATCCGACCGTCCGGACGATGAACTATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail