Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090610
Gene name
Locationscaffold_6:607366..608701
Strand-
Gene length (bp)1335
Transcript length (bp)1068
Coding sequence length (bp)1068
Protein length (aa) 356

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00085 Thioredoxin Thioredoxin 1.6E-08 29 122

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 5 183 5.0E-15
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 22 230 1.0E-13
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 19 242 3.0E-12
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 27 142 3.0E-10
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 1 130 2.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13704|YEU5_SCHPO Thioredoxin domain-containing protein C13F5.05, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPAC13F5.05 PE=3 SV=2 5 183 5.0E-15
sp|Q12404|MPD1_YEAST Protein disulfide-isomerase MPD1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=MPD1 PE=1 SV=1 22 230 1.0E-13
sp|Q869Z0|Y5025_DICDI Putative protein disulfide-isomerase DDB_G0275025 OS=Dictyostelium discoideum GN=DDB_G0275025 PE=1 SV=1 19 242 3.0E-12
sp|Q00216|TIGA_ASPNG Protein disulfide-isomerase tigA OS=Aspergillus niger GN=tigA PE=2 SV=1 27 142 3.0E-10
sp|Q9MAU6|PDI22_ARATH Protein disulfide-isomerase like 2-2 OS=Arabidopsis thaliana GN=PDIL2-2 PE=2 SV=2 1 130 2.0E-08
sp|D4B2L8|PDI_ARTBC Protein disulfide-isomerase OS=Arthroderma benhamiae (strain ATCC MYA-4681 / CBS 112371) GN=ARB_02626 PE=3 SV=1 5 243 9.0E-08
sp|Q92249|ERP38_NEUCR Protein disulfide-isomerase erp38 OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erp38 PE=2 SV=2 27 114 1.0E-06
sp|Q67UF5|PDI23_ORYSJ Protein disulfide isomerase-like 2-3 OS=Oryza sativa subsp. japonica GN=PDIL2-3 PE=2 SV=1 19 123 3.0E-06
sp|P32474|EUG1_YEAST Protein disulfide-isomerase EUG1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=EUG1 PE=1 SV=1 5 163 3.0E-06
sp|Q6NRT6|DJC10_XENLA DnaJ homolog subfamily C member 10 OS=Xenopus laevis GN=dnajc10 PE=2 SV=1 21 145 6.0E-06
[Show less]

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 22 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090610
MFPRLVLLCFALQPSLLLTNALFTDDSLVKMLTPESFKGALEPNVTSMIAFVSSSNSDCQIMAPEYEKAALGLYP
FVPSYAVNCDDEGNKDMCREQNVETFPTTKLFPRGNTEPPVVFEGSSDRSASSYFYWASRRIPSHVTKLYRVEEI
QPWAEKTKENTVVLLLTKEKKVPMLWKVLANQYLGRLELASHRDRRGKSSVALGMEKGEKKDAKVLVYPAGSTEY
VRYEGILKMDSLSNFFETILDGSVDLKTANDKANAEEFTPDEKELEIERKQEAQRIALAHGGLTDFIDFEKAIKA
GHGADYHDVHGYPGMMGETPKKKKSEDDDMEGEEFSPSNDDSMTEENTHRISDEL*
Coding >AgabiH97|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCATTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGTAACAAGTATGATCGCC
TTCGTTTCTTCCTCAAATTCAGATTGCCAAATTATGGCTCCCGAATATGAGAAGGCGGCACTGGGATTGTATCCC
TTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAATAAAGATATGTGTCGGGAACAAAATGTCGAAACG
TTTCCAACTACTAAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTTCAAGTGATAGAAGC
GCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACAGAGTCGAAGAAATC
CAACCCTGGGCTGAAAAGACAAAGGAGAATACCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTA
TGGAAGGTGCTTGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCT
GTCGCGTTGGGAATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATAT
GTTAGATACGAAGGAATATTGAAAATGGATTCCTTGTCGAATTTCTTTGAAACAATCCTTGATGGAAGTGTAGAT
TTGAAAACGGCAAACGACAAAGCGAACGCTGAAGAATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAG
CAAGAGGCACAGCGCATCGCTTTGGCTCATGGTGGACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCG
GGACATGGAGCTGACTATCATGACGTCCATGGTTACCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGC
GAGGACGATGACATGGAAGGGGAAGAGTTCTCCCCAAGCAACGACGATAGTATGACAGAGGAGAATACGCATAGA
ATATCAGATGAGTTATAG
Transcript >AgabiH97|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCATTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGTAACAAGTATGATCGCC
TTCGTTTCTTCCTCAAATTCAGATTGCCAAATTATGGCTCCCGAATATGAGAAGGCGGCACTGGGATTGTATCCC
TTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAATAAAGATATGTGTCGGGAACAAAATGTCGAAACG
TTTCCAACTACTAAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTTCAAGTGATAGAAGC
GCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACAGAGTCGAAGAAATC
CAACCCTGGGCTGAAAAGACAAAGGAGAATACCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTA
TGGAAGGTGCTTGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCT
GTCGCGTTGGGAATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATAT
GTTAGATACGAAGGAATATTGAAAATGGATTCCTTGTCGAATTTCTTTGAAACAATCCTTGATGGAAGTGTAGAT
TTGAAAACGGCAAACGACAAAGCGAACGCTGAAGAATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAG
CAAGAGGCACAGCGCATCGCTTTGGCTCATGGTGGACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCG
GGACATGGAGCTGACTATCATGACGTCCATGGTTACCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGC
GAGGACGATGACATGGAAGGGGAAGAGTTCTCCCCAAGCAACGACGATAGTATGACAGAGGAGAATACGCATAGA
ATATCAGATGAGTTATAG
Gene >AgabiH97|090610
ATGTTTCCTCGACTTGTTCTGCTTTGCTTTGCGCTGCAACCATCGCTTCTGCTAACAAATGCATTGTTTACCGAT
GATTCTCTCGTGAAAATGCTGACGCCCGAGTCATTCAAGGGTGCTTTGGAACCGAACGTGAGGTGCATTCGATAT
TACATGGCGTACCAGCATTGATGCGTGCACAACTAATTGCAGGTAACAAGTATGATCGCCTTCGTTTCTTCCTCA
AATTCAGTACGCTTGTATCTTCATTTGTGATCCGCTCGTACCGATGCTAAACAGGATTGCCAAATTATGGCTCCC
GAATATGAGAAGGCGGCACTGGGATTGTATCCCTTTGTTCCGTCATACGCGGTGAACTGTGATGACGAGGGAAAT
AAAGATATGTGTCGGGAACAAAATGTCGAAACGTTTCCAACTACTAAGGCACGCCATTTCCTTCCTTTTGGGTCC
TTTCTCCTAGAGTCTGATGATACTCTAGCTATTTCCGCGCGGTAATACAGAACCACCCGTGGTATTTGAAGGTTC
AAGTGATAGAAGCGCGAGCTCGTACTTCTATTGGGCTTCACGAAGGATACCCAGCCATGTGACAAAACTATACAG
AGTCGAAGAAATCCAACCCTGGGCTGAAAAGGTCGGTAATCACTATGCCTCGAAACCAAGATTGACTGACATTCG
GAGACAGACAAAGGAGAATACCGTCGTTCTTCTTTTGACTAAAGAAAAGAAAGTACCGATGCTATGGAAGGTGCT
TGCGAATCAATACCTTGGTCGACTTGAATTAGCCTCCCATCGAGATCGTAGAGGAAAGTCATCTGTCGCGTTGGG
AATGGAGAAAGGCGAAAAGAAAGATGCCAAAGTTCTTGTGTATCCGGCAGGCTCAACAGAATATGTTAGATACGA
AGGTAATAAAACGCCTCGAACTGGCACGATACAAATTGCTGAGACGGAATTCTAGGAATATTGAAAATGGATTCC
TTGTCGAATTTCTTTGAAACAATCCTTGATGGAAGTGTAGATTTGAAAACGGCAAACGACAAAGCGAACGCTGAA
GAATTTACGCCAGACGAAAAGGAACTCGAGATTGAGAGGAAGCAAGAGGCACAGCGCATCGCTTTGGCTCATGGT
GGACTTACGGATTTCATTGACTTTGAAAAGGCAATCAAGGCGGGACATGGAGCTGACTATCATGACGTCCATGGT
TACCCAGGAATGATGGGCGAGACTCCTAAGAAGAAGAAAAGCGAGGACGATGACATGGAAGGGGAAGAGTTCTCC
CCAAGCAACGACGATAGTATGACAGAGGAGAATACGCATAGAATATCAGATGAGTTATAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail