Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090410
Gene name
Locationscaffold_6:557589..559266
Strand+
Gene length (bp)1677
Transcript length (bp)864
Coding sequence length (bp)864
Protein length (aa) 288

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01764 Lipase_3 Lipase (class 3) 1.2E-24 89 227

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 123 260 7.0E-18
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 123 260 7.0E-18
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 30 260 4.0E-15
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 128 242 2.0E-14
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 77 265 3.0E-12
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|P61871|LIP_RHINI Lipase OS=Rhizopus niveus PE=1 SV=1 123 260 7.0E-18
sp|P61872|LIP_RHIOR Lipase OS=Rhizopus oryzae PE=1 SV=1 123 260 7.0E-18
sp|P19515|LIP_RHIMI Lipase OS=Rhizomucor miehei PE=1 SV=2 30 260 4.0E-15
sp|O59952|LIP_THELA Lipase OS=Thermomyces lanuginosus GN=LIP PE=1 SV=1 128 242 2.0E-14
sp|P61869|MDLA_PENCY Mono- and diacylglycerol lipase OS=Penicillium cyclopium GN=mdlA PE=3 SV=1 77 265 3.0E-12
sp|P61870|MDLA_PENCA Mono- and diacylglycerol lipase OS=Penicillium camembertii GN=mdlA PE=1 SV=1 77 265 3.0E-12
sp|A2ZW16|PLA1_ORYSJ Phospholipase A1-II 1 OS=Oryza sativa subsp. japonica GN=Os01g0651100 PE=3 SV=2 87 252 4.0E-11
sp|A2WT95|PLA1_ORYSI Phospholipase A1-II 1 OS=Oryza sativa subsp. indica GN=OsI_03083 PE=3 SV=2 87 252 4.0E-11
sp|Q9C8J6|PLA17_ARATH Phospholipase A1-Igamma3, chloroplastic OS=Arabidopsis thaliana GN=At1g51440 PE=1 SV=1 77 228 8.0E-09
sp|Q3EBR6|PLA16_ARATH Phospholipase A1-Igamma2, chloroplastic OS=Arabidopsis thaliana GN=At2g30550 PE=1 SV=2 125 240 3.0E-08
sp|A2QSY5|FAEA_ASPNC Probable feruloyl esterase A OS=Aspergillus niger (strain CBS 513.88 / FGSC A1513) GN=faeA PE=3 SV=1 113 237 4.0E-08
sp|O42807|FAEA_ASPNG Feruloyl esterase A OS=Aspergillus niger GN=faeA PE=1 SV=1 113 237 6.0E-08
sp|Q2UNW5|FAEA_ASPOR Probable feruloyl esterase A OS=Aspergillus oryzae (strain ATCC 42149 / RIB 40) GN=faeA PE=3 SV=1 113 237 2.0E-07
sp|P47145|YJ77_YEAST Putative lipase YJR107W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=YJR107W PE=3 SV=2 77 235 2.0E-07
sp|Q9P979|FAEA_ASPAW Feruloyl esterase A OS=Aspergillus awamori GN=faeA PE=1 SV=3 113 237 3.0E-07
sp|B8NIB8|FAEA_ASPFN Probable feruloyl esterase A OS=Aspergillus flavus (strain ATCC 200026 / FGSC A1120 / NRRL 3357 / JCM 12722 / SRRC 167) GN=faeA PE=3 SV=2 113 237 4.0E-07
sp|Q6F358|PLA6_ORYSJ Phospholipase A1-II 6 OS=Oryza sativa subsp. japonica GN=Os05g0574000 PE=2 SV=1 87 254 5.0E-06
sp|Q7M4U7|LIP_RHIJA Lipase (Fragments) OS=Rhizopus javanicus PE=1 SV=2 185 257 6.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0006629 lipid metabolic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No
GO:0071704 organic substance metabolic process No
GO:0044238 primary metabolic process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Extracellular 0.3048 0.1985 0.8666 0.2996 0.2771 0.0642 0.0739 0.1914 0.0262 0.021

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup106
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|000340
Agaricus bisporus var bisporus H39 AgabiH39|001820
Agaricus bisporus var bisporus H39 AgabiH39|001830
Agaricus bisporus var bisporus H39 AgabiH39|063250
Agaricus bisporus var bisporus H39 AgabiH39|090410
Agaricus bisporus var bisporus H97 AgabiH97|000340
Agaricus bisporus var bisporus H97 AgabiH97|001820
Agaricus bisporus var bisporus H97 AgabiH97|001830
Agaricus bisporus var bisporus H97 AgabiH97|063250
Agaricus bisporus var bisporus H97 AgabiH97|090410 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|214_10
Rhodonia placenta FPRL280 RhoplFPRL280|283_4
Rhodonia placenta FPRL280 RhoplFPRL280|551_2
Rhodonia placenta FPRL280 RhoplFPRL280|551_3

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090410
MTSTNKKCYYYEYQSENDLKLDNATRTPNSFYSLNHSSAYCSPKLTKTWTCGANCDANPNFQPTASGGDGIDVQF
WYVGFDPDLSTIIVAHQGTDPSKIEPLLTDADIFPQNLDSNLFPGLPKDIKVHSGFADAQKETAKDVLAAIRQTM
QDHNTTKVTVASHSLGSAIALLDAISLPLLIPGIDLEMFSYAMPRVGNQEFADYVDANLKLTRITNKKDLVPIVP
GRFLGFHHPSSEIHIQSDDGSFVSCPGQDNTDKRCIVGDTKNIFRARLEDHGGPYDGVRIGC*
Coding >AgabiH97|090410
ATGACATCCACGAACAAGAAATGCTATTACTATGAATATCAATCTGAAAATGATTTAAAGCTCGACAACGCGACG
AGAACTCCAAATTCATTCTACTCCCTTAACCACAGCAGTGCGTATTGTTCGCCGAAACTGACCAAGACGTGGACT
TGCGGAGCCAACTGCGATGCCAATCCGAATTTTCAGCCTACAGCATCAGGTGGTGATGGTATCGATGTACAATTC
TGGTATGTCGGGTTTGATCCTGATTTAAGTACTATCATTGTTGCTCATCAAGGAACTGATCCATCGAAGATTGAA
CCACTCTTGACGGACGCGGATATATTTCCACAAAATCTTGACTCAAATCTATTCCCCGGCCTACCGAAAGATATC
AAAGTGCATAGTGGATTTGCCGACGCTCAGAAAGAGACGGCAAAAGATGTCCTCGCTGCGATTCGGCAAACAATG
CAAGATCATAATACAACTAAAGTCACTGTTGCTAGCCATTCACTAGGTAGTGCGATTGCTCTCCTCGATGCTATA
TCTCTTCCTCTTCTTATTCCGGGGATCGACCTCGAAATGTTTAGTTACGCTATGCCACGTGTTGGGAATCAAGAA
TTTGCGGATTACGTAGATGCAAACCTGAAATTGACTCGTATCACAAACAAAAAGGATCTCGTGCCGATTGTGCCT
GGGAGGTTCCTTGGTTTCCACCACCCGTCAAGTGAAATTCATATTCAAAGCGATGATGGGTCTTTCGTTTCGTGT
CCGGGACAAGATAATACAGATAAACGATGTATTGTTGGAGATACAAAGAACATTTTTAGGGCTCGATTGGAAGAT
CATGGTGGTCCTTATGATGGAGTGCGTATTGGTTGTTGA
Transcript >AgabiH97|090410
ATGACATCCACGAACAAGAAATGCTATTACTATGAATATCAATCTGAAAATGATTTAAAGCTCGACAACGCGACG
AGAACTCCAAATTCATTCTACTCCCTTAACCACAGCAGTGCGTATTGTTCGCCGAAACTGACCAAGACGTGGACT
TGCGGAGCCAACTGCGATGCCAATCCGAATTTTCAGCCTACAGCATCAGGTGGTGATGGTATCGATGTACAATTC
TGGTATGTCGGGTTTGATCCTGATTTAAGTACTATCATTGTTGCTCATCAAGGAACTGATCCATCGAAGATTGAA
CCACTCTTGACGGACGCGGATATATTTCCACAAAATCTTGACTCAAATCTATTCCCCGGCCTACCGAAAGATATC
AAAGTGCATAGTGGATTTGCCGACGCTCAGAAAGAGACGGCAAAAGATGTCCTCGCTGCGATTCGGCAAACAATG
CAAGATCATAATACAACTAAAGTCACTGTTGCTAGCCATTCACTAGGTAGTGCGATTGCTCTCCTCGATGCTATA
TCTCTTCCTCTTCTTATTCCGGGGATCGACCTCGAAATGTTTAGTTACGCTATGCCACGTGTTGGGAATCAAGAA
TTTGCGGATTACGTAGATGCAAACCTGAAATTGACTCGTATCACAAACAAAAAGGATCTCGTGCCGATTGTGCCT
GGGAGGTTCCTTGGTTTCCACCACCCGTCAAGTGAAATTCATATTCAAAGCGATGATGGGTCTTTCGTTTCGTGT
CCGGGACAAGATAATACAGATAAACGATGTATTGTTGGAGATACAAAGAACATTTTTAGGGCTCGATTGGAAGAT
CATGGTGGTCCTTATGATGGAGTGCGTATTGGTTGTTGA
Gene >AgabiH97|090410
ATGACATCCACGAACAAGAAATGCTATGTTCGCTGGCATCAGTTGCATCACCCTGCCAGGCTCAAACCCAAATAT
TTAACAACGAACAACTCAACAATCATTCGCCAAGTACTATGAATATCAATCTGAAAATGATTTAAAGCTCGACAA
CGCGACGAGAACTCCAAATTCATTCTACTCCCTTAACCACAGGTTGGTTGTTCTATACTACTTTTTCTCCCCTCC
AATCATTTGCTTTCTCCATCTATTTTAATTTTCTAATTCTTTAAATGGCCTACCCACTCCTTCGATTCGCCACCT
TTCTACTTGGAGCAAGCACTGCTGTTATTGCAGCGCCAGCTTCGCTAGTTCAACGACAATCATTTTCGACACTTG
CAGCAGCAGACATAGCCAAATTCAAACCATTCACCTTTTTCGCTAGCAGTGCGTATTGTTCGCCGAAACTGACCA
AGACGTGGACTTGCGGAGGTAAGAATTCCATACATAAGATTGTTGTATACATACACACTCACCCTACACTTTAAA
AAAAATCATCCCTAATAGCCAACTGCGATGCCAATCCGAATTTTCAGCCTACAGCATCAGGTGGTGATGGTATCG
ATGTACAATTCTGGTATGTCGGGTTTGATCCTGATTTAAGTGTATGTTGTCTATGAATATTGTTTCGTTATTATC
TTTTTTGCTGATTTCATAACGAGAATTTAGACTATCATTGTTGCTCATCAAGGAACTGATCCATCGAAGATGTGC
GTAACAAAAATAAAAAACTGACATACGATTTTTTCTAAACTCACAGTCAACGGTTTATTCTAGTGAACCACTCTT
GACGGACGCGGATATATTTCCACAAAATCTTGACTCAAATCTATTCCCCGGCCTACCGAAAGATATCAAAGTGCA
TAGTGGATTTGCCGACGCTCAGAAAGAGTACGTTCATTATCATTATTCTGTAAATACTCGCTTAATAATTATCTT
TGACAGGACGGCAAAAGATGTCCTCGCTGCGATTCGGCAAACAATGCAAGATCATAATACAACTAAAGTCACTGT
TGCTAGCCATTCACTAGGTACGAATACATTCGAATTTTTTTGAGCTTTATTGGTTAATTTCATTATCAATGAATT
GAAGGTAGTGCGATTGCTCTCCTCGATGCTATATCTCTTCCTCTTCTTATTCCGGGGATCGACCTCGAAATGTTT
AGTTACGCTATGCCACGTGTAAGTCGAGTCGGGTTCACAAAGGACAGGCGGTTTTGAGAAACATAATTTAATAGG
TTGGGAATCAAGAATTTGCGGATTACGTAGATGCAAACCTGAAATTGACTCGTATCACAAACAAGTAAGCTTTTC
TTTCTTACAATTTTGATTTGAACGGGCTTTTGAATTGTATGTACAGAAAGGATCTCGTGCCGATTGTGCCTGGGA
GGTTCCTTGGTTTCCACCACCCGTCAAGTGAAATTCATATTCAAAGCGATGATGGGTCTTTCGTTTCGTGTCCGG
GACAAGATAATACAGATAAACGATGTATTGTTGGAGATACAAAGAACATTTTTAGGGCTCGATTGGAAGATCATG
GTGGTACGCATTTTTGTATCCTTGAAATTTTGATTTTGTTATGTTGACTTTTGCTCTCGTTTTATTCTAGGTCCT
TATGATGGAGTGCGTATTGGTTGTTGA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail