Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090280
Gene name
Locationscaffold_6:523113..528862
Strand-
Gene length (bp)5749
Transcript length (bp)4914
Coding sequence length (bp)4914
Protein length (aa) 1638

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00501 AMP-binding AMP-binding enzyme 2.4E-52 81 451
PF00550 PP-binding Phosphopantetheine attachment site 3.9E-11 687 752
PF13920 zf-C3HC4_3 Zinc finger, C3HC4 type (RING finger) 2.2E-09 1566 1611
PF13923 zf-C3HC4_2 Zinc finger, C3HC4 type (RING finger) 3.0E-07 1568 1605
PF13639 zf-RING_2 Ring finger domain 8.5E-07 1568 1606
PF00097 zf-C3HC4 Zinc finger, C3HC4 type (RING finger) 8.2E-06 1568 1605
PF13445 zf-RING_UBOX RING-type zinc-finger 2.3E-05 1568 1603

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 85 542 5.0E-56
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 34 550 6.0E-45
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 81 549 9.0E-44
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 45 545 2.0E-41
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 58 542 1.0E-37
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74976|FAT2_SCHPO Putative peroxisomal-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC1827.03c PE=1 SV=1 85 542 5.0E-56
sp|P38137|FAT2_YEAST Peroxisomal-coenzyme A synthetase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=PCS60 PE=1 SV=1 34 550 6.0E-45
sp|Q9SMT7|4CLLA_ARATH Oxalate--CoA ligase OS=Arabidopsis thaliana GN=AAE3 PE=1 SV=1 81 549 9.0E-44
sp|Q0K844|SAUT_CUPNH Probable sulfoacetate--CoA ligase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=sauT PE=2 SV=1 45 545 2.0E-41
sp|O07610|LCFB_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfB PE=2 SV=2 58 542 1.0E-37
sp|Q57TJ0|CAIC_SALCH Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella choleraesuis (strain SC-B67) GN=caiC PE=3 SV=1 193 545 1.0E-30
sp|C0Q4L3|CAIC_SALPC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi C (strain RKS4594) GN=caiC PE=3 SV=1 193 545 1.0E-30
sp|A9MYJ6|CAIC_SALPB Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=caiC PE=3 SV=1 162 545 1.0E-30
sp|Q8Z9L4|CAIC_SALTI Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhi GN=caiC PE=3 SV=1 193 545 2.0E-30
sp|B4TWR4|CAIC_SALSV Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella schwarzengrund (strain CVM19633) GN=caiC PE=3 SV=1 193 545 2.0E-30
sp|B5F750|CAIC_SALA4 Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella agona (strain SL483) GN=caiC PE=3 SV=1 162 545 2.0E-30
sp|A9MQH7|CAIC_SALAR Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=caiC PE=3 SV=1 162 545 3.0E-30
sp|B4T6J6|CAIC_SALNS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella newport (strain SL254) GN=caiC PE=3 SV=1 193 545 3.0E-30
sp|B5FHG5|CAIC_SALDC Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella dublin (strain CT_02021853) GN=caiC PE=3 SV=1 193 545 3.0E-30
sp|Q8ZRX4|CAIC_SALTY Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=caiC PE=3 SV=1 193 545 3.0E-30
sp|B4TIH0|CAIC_SALHS Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella heidelberg (strain SL476) GN=caiC PE=3 SV=1 193 545 3.0E-30
sp|Q6ETN3|4CL3_ORYSJ Probable 4-coumarate--CoA ligase 3 OS=Oryza sativa subsp. japonica GN=4CL3 PE=2 SV=1 85 552 4.0E-30
sp|B5R1R0|CAIC_SALEP Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella enteritidis PT4 (strain P125109) GN=caiC PE=3 SV=1 193 545 4.0E-30
sp|Q67W82|4CL4_ORYSJ Probable 4-coumarate--CoA ligase 4 OS=Oryza sativa subsp. japonica GN=4CL4 PE=2 SV=1 85 561 5.0E-30
sp|B1IRD9|CAIC_ECOLC Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=caiC PE=3 SV=2 155 545 5.0E-30
sp|A7ZHC8|CAIC_ECO24 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=caiC PE=3 SV=2 155 545 8.0E-30
sp|Q83MG9|CAIC_SHIFL Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri GN=caiC PE=3 SV=2 155 545 1.0E-29
sp|B7M0D4|CAIC_ECO8A Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O8 (strain IAI1) GN=caiC PE=3 SV=2 155 545 1.0E-29
sp|Q3Z5X2|CAIC_SHISS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella sonnei (strain Ss046) GN=caiC PE=3 SV=2 155 545 1.0E-29
sp|B7L4G0|CAIC_ECO55 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain 55989 / EAEC) GN=caiC PE=3 SV=2 155 545 2.0E-29
sp|B6HYY8|CAIC_ECOSE Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SE11) GN=caiC PE=3 SV=2 155 545 2.0E-29
sp|B4EY25|CAIC_PROMH Probable crotonobetaine/carnitine-CoA ligase OS=Proteus mirabilis (strain HI4320) GN=caiC PE=3 SV=1 192 545 2.0E-29
sp|B7NHE1|CAIC_ECO7I Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=caiC PE=3 SV=2 155 545 2.0E-29
sp|B7N7R2|CAIC_ECOLU Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=caiC PE=3 SV=2 155 545 2.0E-29
sp|B5BL55|CAIC_SALPK Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain AKU_12601) GN=caiC PE=3 SV=1 193 545 3.0E-29
sp|Q5PIL0|CAIC_SALPA Probable crotonobetaine/carnitine-CoA ligase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=caiC PE=3 SV=1 193 545 3.0E-29
sp|B5YYD1|CAIC_ECO5E Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=caiC PE=3 SV=1 155 545 3.0E-29
sp|Q8XA34|CAIC_ECO57 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O157:H7 GN=caiC PE=3 SV=2 155 545 3.0E-29
sp|A7ZVY7|CAIC_ECOHS Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O9:H4 (strain HS) GN=caiC PE=3 SV=2 155 545 3.0E-29
sp|P31552|CAIC_ECOLI Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12) GN=caiC PE=1 SV=2 155 545 3.0E-29
sp|B1XBG2|CAIC_ECODH Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / DH10B) GN=caiC PE=3 SV=2 155 545 3.0E-29
sp|C4ZPW3|CAIC_ECOBW Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=caiC PE=3 SV=2 155 545 3.0E-29
sp|B1LFX0|CAIC_ECOSM Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=caiC PE=3 SV=1 155 545 3.0E-29
sp|Q1RGG1|CAIC_ECOUT Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli (strain UTI89 / UPEC) GN=caiC PE=3 SV=2 155 545 4.0E-29
sp|A1A787|CAIC_ECOK1 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O1:K1 / APEC GN=caiC PE=3 SV=2 155 545 4.0E-29
sp|B7MAG0|CAIC_ECO45 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=caiC PE=3 SV=2 155 545 4.0E-29
sp|O24145|4CL1_TOBAC 4-coumarate--CoA ligase 1 OS=Nicotiana tabacum GN=4CL1 PE=2 SV=1 81 553 5.0E-29
sp|B7UI83|CAIC_ECO27 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=caiC PE=3 SV=1 193 545 2.0E-28
sp|O24146|4CL2_TOBAC 4-coumarate--CoA ligase 2 OS=Nicotiana tabacum GN=4CL2 PE=2 SV=1 81 553 3.0E-28
sp|A8ALR6|CAIC_CITK8 Probable crotonobetaine/carnitine-CoA ligase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=caiC PE=3 SV=1 193 545 4.0E-28
sp|B7LWM8|CAIC_ESCF3 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=caiC PE=3 SV=2 193 542 6.0E-28
sp|Q9S725|4CL2_ARATH 4-coumarate--CoA ligase 2 OS=Arabidopsis thaliana GN=4CL2 PE=1 SV=2 81 550 1.0E-27
sp|B7MNP4|CAIC_ECO81 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O81 (strain ED1a) GN=caiC PE=3 SV=2 155 545 1.0E-27
sp|Q8FLA5|CAIC_ECOL6 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=caiC PE=3 SV=2 193 545 2.0E-27
sp|Q0TLV2|CAIC_ECOL5 Probable crotonobetaine/carnitine-CoA ligase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=caiC PE=3 SV=2 193 545 2.0E-27
sp|P41636|4CL_PINTA 4-coumarate--CoA ligase OS=Pinus taeda GN=4CL PE=2 SV=1 114 550 3.0E-27
sp|A8FGK6|MENE_BACP2 2-succinylbenzoate--CoA ligase OS=Bacillus pumilus (strain SAFR-032) GN=menE PE=3 SV=1 191 548 1.0E-26
sp|Q3URE1|ACSF3_MOUSE Acyl-CoA synthetase family member 3, mitochondrial OS=Mus musculus GN=Acsf3 PE=1 SV=2 193 549 5.0E-26
sp|Q32K60|CAIC_SHIDS Probable crotonobetaine/carnitine-CoA ligase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=caiC PE=3 SV=2 155 545 9.0E-26
sp|Q8GB18|CAIC_PROSL Probable crotonobetaine/carnitine-CoA ligase OS=Proteus sp. (strain LE138) GN=caiC PE=3 SV=1 192 545 4.0E-25
sp|Q0T8F7|CAIC_SHIF8 Probable crotonobetaine/carnitine-CoA ligase OS=Shigella flexneri serotype 5b (strain 8401) GN=caiC PE=3 SV=3 155 496 6.0E-25
sp|Q8H151|AAE13_ARATH Malonate--CoA ligase OS=Arabidopsis thaliana GN=AAE13 PE=1 SV=1 192 549 9.0E-25
sp|Q10S72|4CLL4_ORYSJ 4-coumarate--CoA ligase-like 4 OS=Oryza sativa subsp. japonica GN=4CLL4 PE=2 SV=1 81 547 1.0E-24
sp|Q65FT5|MENE_BACLD 2-succinylbenzoate--CoA ligase OS=Bacillus licheniformis (strain ATCC 14580 / DSM 13 / JCM 2505 / NBRC 12200 / NCIMB 9375 / NRRL NRS-1264 / Gibson 46) GN=menE PE=3 SV=1 192 545 1.0E-24
sp|Q6ZAC1|4CL5_ORYSJ Probable 4-coumarate--CoA ligase 5 OS=Oryza sativa subsp. japonica GN=4CL5 PE=2 SV=1 201 553 2.0E-24
sp|Q84P23|4CLL9_ARATH 4-coumarate--CoA ligase-like 9 OS=Arabidopsis thaliana GN=4CLL9 PE=1 SV=2 194 547 3.0E-24
sp|Q58DN7|ACSF3_BOVIN Acyl-CoA synthetase family member 3, mitochondrial OS=Bos taurus GN=ACSF3 PE=2 SV=1 193 549 6.0E-24
sp|P14912|4CL1_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL1 PE=2 SV=1 81 550 8.0E-24
sp|P38135|FADK_ECOLI Short-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadK PE=1 SV=3 193 549 3.0E-23
sp|P14913|4CL2_PETCR 4-coumarate--CoA ligase 1 OS=Petroselinum crispum GN=4CL2 PE=2 SV=1 81 550 4.0E-23
sp|Q8VYJ1|MENE_ARATH 2-succinylbenzoate--CoA ligase, chloroplastic/peroxisomal OS=Arabidopsis thaliana GN=AAE14 PE=1 SV=1 164 467 7.0E-23
sp|Q9S777|4CL3_ARATH 4-coumarate--CoA ligase 3 OS=Arabidopsis thaliana GN=4CL3 PE=1 SV=1 81 549 7.0E-23
sp|P94547|LCFA_BACSU Long-chain-fatty-acid--CoA ligase OS=Bacillus subtilis (strain 168) GN=lcfA PE=3 SV=1 81 545 2.0E-22
sp|Q54P78|4CL2_DICDI Probable 4-coumarate--CoA ligase 2 OS=Dictyostelium discoideum GN=4cl2 PE=3 SV=1 188 545 2.0E-22
sp|P17814|4CL1_ORYSJ Probable 4-coumarate--CoA ligase 1 OS=Oryza sativa subsp. japonica GN=4CL1 PE=2 SV=2 187 549 2.0E-22
sp|C5D6U5|MENE_GEOSW 2-succinylbenzoate--CoA ligase OS=Geobacillus sp. (strain WCH70) GN=menE PE=3 SV=1 157 557 5.0E-22
sp|O31826|YNGI_BACSU Putative acyl-CoA synthetase YngI OS=Bacillus subtilis (strain 168) GN=yngI PE=3 SV=1 187 548 8.0E-22
sp|Q0S7V5|FAD3_RHOJR 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Rhodococcus jostii (strain RHA1) GN=fadD3 PE=1 SV=1 60 542 9.0E-22
sp|P31685|4CL2_SOLTU 4-coumarate--CoA ligase 2 OS=Solanum tuberosum GN=4CL2 PE=3 SV=1 81 550 1.0E-21
sp|Q4G176|ACSF3_HUMAN Acyl-CoA synthetase family member 3, mitochondrial OS=Homo sapiens GN=ACSF3 PE=1 SV=3 196 539 1.0E-21
sp|Q0DV32|4CLL1_ORYSJ 4-coumarate--CoA ligase-like 1 OS=Oryza sativa subsp. japonica GN=4CLL1 PE=2 SV=2 81 545 1.0E-21
sp|P31684|4CL1_SOLTU 4-coumarate--CoA ligase 1 OS=Solanum tuberosum GN=4CL1 PE=3 SV=1 81 550 1.0E-21
sp|Q54P77|4CL1_DICDI Probable 4-coumarate--CoA ligase 1 OS=Dictyostelium discoideum GN=4cl1 PE=3 SV=1 188 545 2.0E-21
sp|Q7XXL2|4CLL9_ORYSJ 4-coumarate--CoA ligase-like 9 OS=Oryza sativa subsp. japonica GN=4CLL9 PE=2 SV=2 81 545 3.0E-21
sp|Q42982|4CL2_ORYSJ Probable 4-coumarate--CoA ligase 2 OS=Oryza sativa subsp. japonica GN=4CL2 PE=2 SV=2 114 550 5.0E-21
sp|Q9M0X9|4CLL7_ARATH 4-coumarate--CoA ligase-like 7 OS=Arabidopsis thaliana GN=4CLL7 PE=1 SV=1 57 549 8.0E-21
sp|Q9LU36|4CL4_ARATH 4-coumarate--CoA ligase 4 OS=Arabidopsis thaliana GN=4CL4 PE=1 SV=1 81 549 1.0E-20
sp|Q69RG7|4CLL7_ORYSJ 4-coumarate--CoA ligase-like 7 OS=Oryza sativa subsp. japonica GN=4CLL7 PE=2 SV=1 81 551 1.0E-20
sp|P96843|FAD3_MYCTU 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD3 PE=1 SV=1 81 550 2.0E-20
sp|Q84P24|4CLL6_ARATH 4-coumarate--CoA ligase-like 6 OS=Arabidopsis thaliana GN=4CLL6 PE=2 SV=2 81 549 2.0E-20
sp|Q7TN78|ACSM4_RAT Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Rattus norvegicus GN=Acsm4 PE=2 SV=1 201 542 3.0E-20
sp|P63526|MENE_STAAN 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain N315) GN=menE PE=1 SV=1 100 547 3.0E-20
sp|P63525|MENE_STAAM 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu50 / ATCC 700699) GN=menE PE=3 SV=1 100 547 3.0E-20
sp|A5ITW2|MENE_STAA9 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH9) GN=menE PE=3 SV=1 100 547 3.0E-20
sp|A6U2Q7|MENE_STAA2 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain JH1) GN=menE PE=3 SV=1 100 547 3.0E-20
sp|A7X3P0|MENE_STAA1 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Mu3 / ATCC 700698) GN=menE PE=3 SV=1 100 547 3.0E-20
sp|Q8ZES9|LCFA_YERPE Long-chain-fatty-acid--CoA ligase OS=Yersinia pestis GN=fadD PE=3 SV=1 235 545 3.0E-20
sp|Q6GFR0|MENE_STAAR 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MRSA252) GN=menE PE=3 SV=1 100 547 3.0E-20
sp|Q84P26|4CLL8_ARATH 4-coumarate--CoA ligase-like 8 OS=Arabidopsis thaliana GN=4CLL8 PE=2 SV=2 81 547 4.0E-20
sp|Q8NVZ4|MENE_STAAW 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MW2) GN=menE PE=3 SV=1 100 547 5.0E-20
sp|Q6G8D6|MENE_STAAS 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain MSSA476) GN=menE PE=3 SV=1 100 547 5.0E-20
sp|Q80W40|ACSM4_MOUSE Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Mus musculus GN=Acsm4 PE=2 SV=1 81 542 6.0E-20
sp|Q00594|ALKK_PSEOL Medium-chain-fatty-acid--CoA ligase OS=Pseudomonas oleovorans GN=alkK PE=3 SV=1 193 550 7.0E-20
sp|Q838K1|MENE_ENTFA 2-succinylbenzoate--CoA ligase OS=Enterococcus faecalis (strain ATCC 700802 / V583) GN=menE PE=3 SV=1 191 542 1.0E-19
sp|Q5SKN9|LCFCS_THET8 Long-chain-fatty-acid--CoA ligase OS=Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579) GN=TTHA0604 PE=1 SV=1 201 542 1.0E-19
sp|Q53634|MENE_STAAU 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus GN=menE PE=3 SV=1 100 547 1.0E-19
sp|A8Z4L9|MENE_STAAT 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300 / TCH1516) GN=menE PE=3 SV=1 100 547 1.0E-19
sp|A6QHX6|MENE_STAAE 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain Newman) GN=menE PE=3 SV=1 100 547 1.0E-19
sp|Q5HEY2|MENE_STAAC 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain COL) GN=menE PE=3 SV=1 100 547 1.0E-19
sp|Q2G2V3|MENE_STAA8 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain NCTC 8325) GN=menE PE=3 SV=1 100 547 1.0E-19
sp|Q2FFU9|MENE_STAA3 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain USA300) GN=menE PE=3 SV=1 100 547 1.0E-19
sp|Q84P25|4CLL2_ARATH 4-coumarate--CoA ligase-like 2 OS=Arabidopsis thaliana GN=4CLL2 PE=2 SV=2 184 547 1.0E-19
sp|Q54P79|4CL3_DICDI Probable 4-coumarate--CoA ligase 3 OS=Dictyostelium discoideum GN=4cl3 PE=3 SV=2 188 545 2.0E-19
sp|Q2YTP0|MENE_STAAB 2-succinylbenzoate--CoA ligase OS=Staphylococcus aureus (strain bovine RF122 / ET3-1) GN=menE PE=3 SV=1 100 547 3.0E-19
sp|Q7WSH3|FADD3_COMTE 3-[(3aS,4S,7aS)-7a-methyl-1,5-dioxo-octahydro-1H-inden-4-yl]propanoyl:CoA ligase OS=Comamonas testosteroni GN=fadD3 PE=3 SV=1 193 545 3.0E-19
sp|Q84P21|4CLL5_ARATH 4-coumarate--CoA ligase-like 5 OS=Arabidopsis thaliana GN=4CLL5 PE=1 SV=2 193 547 4.0E-19
sp|P0C5B6|4CLL4_ARATH 4-coumarate--CoA ligase-like 4 OS=Arabidopsis thaliana GN=4CLL4 PE=2 SV=1 193 547 5.0E-19
sp|Q9FFE6|AAE5_ARATH Probable acyl-activating enzyme 5, peroxisomal OS=Arabidopsis thaliana GN=AAE5 PE=2 SV=1 201 550 5.0E-19
sp|O80658|AAE4_ARATH Probable acyl-activating enzyme 4 OS=Arabidopsis thaliana GN=AEE4 PE=2 SV=1 201 539 6.0E-19
sp|O68040|ACSA_RHOCB Acetyl-coenzyme A synthetase OS=Rhodobacter capsulatus (strain ATCC BAA-309 / NBRC 16581 / SB1003) GN=acsA PE=3 SV=1 21 547 9.0E-19
sp|A7Z809|MENE_BACMF 2-succinylbenzoate--CoA ligase OS=Bacillus methylotrophicus (strain DSM 23117 / BGSC 10A6 / FZB42) GN=menE PE=3 SV=1 192 545 1.0E-18
sp|Q6GLK6|ACSF3_XENLA Acyl-CoA synthetase family member 3, mitochondrial OS=Xenopus laevis GN=acsf3 PE=2 SV=1 112 545 1.0E-18
sp|O24540|4CL_VANPL 4-coumarate--CoA ligase OS=Vanilla planifolia GN=4CL PE=3 SV=1 81 542 1.0E-18
sp|Q9FFE9|AAE6_ARATH Probable acyl-activating enzyme 6 OS=Arabidopsis thaliana GN=AAE6 PE=2 SV=1 201 550 1.0E-18
sp|Q83JV7|AAS_SHIFL Bifunctional protein Aas OS=Shigella flexneri GN=aas PE=3 SV=1 85 556 3.0E-18
sp|Q0T128|AAS_SHIF8 Bifunctional protein Aas OS=Shigella flexneri serotype 5b (strain 8401) GN=aas PE=3 SV=1 85 556 3.0E-18
sp|Q3UNX5|ACSM3_MOUSE Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Mus musculus GN=Acsm3 PE=1 SV=2 81 548 4.0E-18
sp|Q9AJS8|3HBCL_THAAR 3-hydroxybenzoate--CoA/4-hydroxybenzoate--CoA ligase OS=Thauera aromatica GN=hcl PE=1 SV=1 193 549 5.0E-18
sp|Q6YYZ2|4CLL3_ORYSJ 4-coumarate--CoA ligase-like 3 OS=Oryza sativa subsp. japonica GN=4CLL3 PE=3 SV=1 81 542 6.0E-18
sp|P39062|ACSA_BACSU Acetyl-coenzyme A synthetase OS=Bacillus subtilis (strain 168) GN=acsA PE=1 SV=1 85 553 7.0E-18
sp|Q6SKG1|ACSM3_RAT Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Rattus norvegicus GN=Acsm3 PE=2 SV=1 13 548 7.0E-18
sp|Q6FLU2|ACS1_CANGA Acetyl-coenzyme A synthetase 1 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS1 PE=3 SV=1 81 550 7.0E-18
sp|Q42524|4CL1_ARATH 4-coumarate--CoA ligase 1 OS=Arabidopsis thaliana GN=4CL1 PE=1 SV=1 84 550 7.0E-18
sp|B2TYQ5|AAS_SHIB3 Bifunctional protein Aas OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=aas PE=3 SV=1 85 556 8.0E-18
sp|Q01574|ACS1_YEAST Acetyl-coenzyme A synthetase 1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS1 PE=1 SV=2 81 550 8.0E-18
sp|B4TUM9|AAS_SALSV Bifunctional protein Aas OS=Salmonella schwarzengrund (strain CVM19633) GN=aas PE=3 SV=1 27 555 9.0E-18
sp|B7NVY2|AAS_ECO7I Bifunctional protein Aas OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=aas PE=3 SV=1 85 556 9.0E-18
sp|B5BFH6|AAS_SALPK Bifunctional protein Aas OS=Salmonella paratyphi A (strain AKU_12601) GN=aas PE=3 SV=1 85 555 1.0E-17
sp|Q5PEN7|AAS_SALPA Bifunctional protein Aas OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=aas PE=3 SV=1 85 555 1.0E-17
sp|Q3YY21|AAS_SHISS Bifunctional protein Aas OS=Shigella sonnei (strain Ss046) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|B6I6W1|AAS_ECOSE Bifunctional protein Aas OS=Escherichia coli (strain SE11) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|B7LF13|AAS_ECO55 Bifunctional protein Aas OS=Escherichia coli (strain 55989 / EAEC) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|B1IU08|AAS_ECOLC Bifunctional protein Aas OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|A8A3X0|AAS_ECOHS Bifunctional protein Aas OS=Escherichia coli O9:H4 (strain HS) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|A7ZQU2|AAS_ECO24 Bifunctional protein Aas OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|P23971|MENE_BACSU 2-succinylbenzoate--CoA ligase OS=Bacillus subtilis (strain 168) GN=menE PE=1 SV=2 191 545 1.0E-17
sp|P63521|LCFA_SALTY Long-chain-fatty-acid--CoA ligase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=fadD PE=3 SV=1 193 545 1.0E-17
sp|P63522|LCFA_SALTI Long-chain-fatty-acid--CoA ligase OS=Salmonella typhi GN=fadD PE=3 SV=1 193 545 1.0E-17
sp|B7N768|AAS_ECOLU Bifunctional protein Aas OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|P31119|AAS_ECOLI Bifunctional protein Aas OS=Escherichia coli (strain K12) GN=aas PE=1 SV=2 85 556 1.0E-17
sp|B1XDP2|AAS_ECODH Bifunctional protein Aas OS=Escherichia coli (strain K12 / DH10B) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|C4ZZY9|AAS_ECOBW Bifunctional protein Aas OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|Q8ZMA4|AAS_SALTY Bifunctional protein Aas OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=aas PE=3 SV=1 85 555 1.0E-17
sp|Q3E6Y4|4CLL3_ARATH 4-coumarate--CoA ligase-like 3 OS=Arabidopsis thaliana GN=4CLL3 PE=2 SV=2 176 547 1.0E-17
sp|Q8FEA6|AAS_ECOL6 Bifunctional protein Aas OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|B7UHQ4|AAS_ECO27 Bifunctional protein Aas OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=aas PE=3 SV=1 85 556 1.0E-17
sp|B4T503|AAS_SALNS Bifunctional protein Aas OS=Salmonella newport (strain SL254) GN=aas PE=3 SV=1 85 555 1.0E-17
sp|P69451|LCFA_ECOLI Long-chain-fatty-acid--CoA ligase OS=Escherichia coli (strain K12) GN=fadD PE=1 SV=1 193 545 1.0E-17
sp|P69452|LCFA_ECOL6 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=fadD PE=3 SV=1 193 545 1.0E-17
sp|B5RDY6|AAS_SALG2 Bifunctional protein Aas OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|B4TGR5|AAS_SALHS Bifunctional protein Aas OS=Salmonella heidelberg (strain SL476) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|B5QWU2|AAS_SALEP Bifunctional protein Aas OS=Salmonella enteritidis PT4 (strain P125109) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|B5F4V4|AAS_SALA4 Bifunctional protein Aas OS=Salmonella agona (strain SL483) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|A9N3H8|AAS_SALPB Bifunctional protein Aas OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|B5Z4F4|AAS_ECO5E Bifunctional protein Aas OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=aas PE=3 SV=1 85 556 2.0E-17
sp|Q8X6J8|AAS_ECO57 Bifunctional protein Aas OS=Escherichia coli O157:H7 GN=aas PE=3 SV=1 85 556 2.0E-17
sp|B7LNJ2|AAS_ESCF3 Bifunctional protein Aas OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=aas PE=3 SV=1 85 556 2.0E-17
sp|B5FUB9|AAS_SALDC Bifunctional protein Aas OS=Salmonella dublin (strain CT_02021853) GN=aas PE=3 SV=1 85 555 2.0E-17
sp|P40806|PKSJ_BACSU Polyketide synthase PksJ OS=Bacillus subtilis (strain 168) GN=pksJ PE=1 SV=3 193 557 2.0E-17
sp|A1WY97|ACSA_HALHL Acetyl-coenzyme A synthetase OS=Halorhodospira halophila (strain DSM 244 / SL1) GN=acsA PE=3 SV=1 81 547 3.0E-17
sp|Q8RU95|4CLL6_ORYSJ 4-coumarate--CoA ligase-like 6 OS=Oryza sativa subsp. japonica GN=4CLL6 PE=2 SV=2 198 545 3.0E-17
sp|Q6BQF2|ACS1_DEBHA Acetyl-coenzyme A synthetase 1 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS1 PE=3 SV=1 4 550 3.0E-17
sp|Q8Z406|AAS_SALTI Bifunctional protein Aas OS=Salmonella typhi GN=aas PE=3 SV=1 85 555 5.0E-17
sp|Q08AH3|ACS2A_HUMAN Acyl-coenzyme A synthetase ACSM2A, mitochondrial OS=Homo sapiens GN=ACSM2A PE=1 SV=2 81 548 5.0E-17
sp|B1LR34|AAS_ECOSM Bifunctional protein Aas OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=aas PE=3 SV=1 181 556 5.0E-17
sp|Q9BEA2|ACSM1_BOVIN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Bos taurus GN=ACSM1 PE=1 SV=2 192 548 5.0E-17
sp|Q8XDR6|LCFA_ECO57 Long-chain-fatty-acid--CoA ligase OS=Escherichia coli O157:H7 GN=fadD PE=3 SV=1 193 545 6.0E-17
sp|C0PXJ8|AAS_SALPC Bifunctional protein Aas OS=Salmonella paratyphi C (strain RKS4594) GN=aas PE=3 SV=1 85 555 7.0E-17
sp|Q57KA7|AAS_SALCH Bifunctional protein Aas OS=Salmonella choleraesuis (strain SC-B67) GN=aas PE=3 SV=1 85 555 7.0E-17
sp|P96575|YDAB_BACSU Putative acyl--CoA ligase YdaB OS=Bacillus subtilis (strain 168) GN=ydaB PE=3 SV=2 343 542 9.0E-17
sp|Q1R7H5|AAS_ECOUT Bifunctional protein Aas OS=Escherichia coli (strain UTI89 / UPEC) GN=aas PE=3 SV=1 85 556 9.0E-17
sp|A1AF47|AAS_ECOK1 Bifunctional protein Aas OS=Escherichia coli O1:K1 / APEC GN=aas PE=3 SV=1 85 556 9.0E-17
sp|B7MLI2|AAS_ECO45 Bifunctional protein Aas OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=aas PE=3 SV=1 85 556 9.0E-17
sp|Q5KVX9|MENE_GEOKA 2-succinylbenzoate--CoA ligase OS=Geobacillus kaustophilus (strain HTA426) GN=menE PE=3 SV=1 129 549 9.0E-17
sp|C1AA44|ACSA_GEMAT Acetyl-coenzyme A synthetase OS=Gemmatimonas aurantiaca (strain T-27 / DSM 14586 / JCM 11422 / NBRC 100505) GN=acsA PE=3 SV=1 84 542 1.0E-16
sp|F4HUK6|AAE1_ARATH Probable acyl-activating enzyme 1, peroxisomal OS=Arabidopsis thaliana GN=AAE1 PE=2 SV=1 191 548 1.0E-16
sp|Q0TDZ6|AAS_ECOL5 Bifunctional protein Aas OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=aas PE=3 SV=1 85 556 1.0E-16
sp|B7HTW3|MENE_BACC7 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH187) GN=menE PE=3 SV=1 183 547 2.0E-16
sp|A7MR36|AAS_CROS8 Bifunctional protein Aas OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=aas PE=3 SV=1 181 547 2.0E-16
sp|Q5LRT0|DMDB_RUEPO 3-methylmercaptopropionyl-CoA ligase OS=Ruegeria pomeroyi (strain ATCC 700808 / DSM 15171 / DSS-3) GN=dmdB PE=1 SV=1 201 549 2.0E-16
sp|A6TDH2|AAS_KLEP7 Bifunctional protein Aas OS=Klebsiella pneumoniae subsp. pneumoniae (strain ATCC 700721 / MGH 78578) GN=aas PE=3 SV=1 27 545 2.0E-16
sp|Q9LPK6|AEE9_ARATH Probable acyl-activating enzyme 9 OS=Arabidopsis thaliana GN=AEE9 PE=2 SV=1 201 539 3.0E-16
sp|Q6NUN0|ACSM5_HUMAN Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Homo sapiens GN=ACSM5 PE=1 SV=2 81 545 3.0E-16
sp|Q8ENZ7|MENE_OCEIH 2-succinylbenzoate--CoA ligase OS=Oceanobacillus iheyensis (strain DSM 14371 / JCM 11309 / KCTC 3954 / HTE831) GN=menE PE=3 SV=1 192 547 3.0E-16
sp|B9J2F2|MENE_BACCQ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain Q1) GN=menE PE=3 SV=1 183 545 3.0E-16
sp|Q92AY8|MENE_LISIN 2-succinylbenzoate--CoA ligase OS=Listeria innocua serovar 6a (strain CLIP 11262) GN=menE PE=3 SV=2 157 548 3.0E-16
sp|Q758X0|ACS1_ASHGO Acetyl-coenzyme A synthetase 1 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS1 PE=3 SV=1 197 550 3.0E-16
sp|Q8CS21|MENE_STAES 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 12228) GN=menE PE=3 SV=1 192 542 5.0E-16
sp|Q72YK9|MENE_BACC1 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 10987 / NRS 248) GN=menE PE=3 SV=1 183 545 5.0E-16
sp|Q9C8D4|AAE11_ARATH Butyrate--CoA ligase AAE11, peroxisomal OS=Arabidopsis thaliana GN=AAE11 PE=1 SV=1 188 545 6.0E-16
sp|Q9CHK3|MENE_LACLA 2-succinylbenzoate--CoA ligase OS=Lactococcus lactis subsp. lactis (strain IL1403) GN=menE PE=3 SV=2 193 545 7.0E-16
sp|P31687|4CL2_SOYBN 4-coumarate--CoA ligase 2 OS=Glycine max PE=2 SV=2 193 549 7.0E-16
sp|Q2G512|ACSA_NOVAD Acetyl-coenzyme A synthetase OS=Novosphingobium aromaticivorans (strain DSM 12444 / F199) GN=acsA PE=3 SV=1 21 547 9.0E-16
sp|Q9HV66|ACSA2_PSEAE Acetyl-coenzyme A synthetase 2 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA2 PE=3 SV=1 81 547 1.0E-15
sp|C8VTR6|Y0074_EMENI Putative acyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=AN10074 PE=3 SV=1 187 542 1.0E-15
sp|Q0P4F7|ACSF2_DANRE Acyl-CoA synthetase family member 2, mitochondrial OS=Danio rerio GN=acsf2 PE=2 SV=1 193 551 1.0E-15
sp|Q816I1|MENE_BACCR 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ATCC 14579 / DSM 31 / JCM 2152 / NBRC 15305 / NCIMB 9373 / NRRL B-3711) GN=menE PE=3 SV=1 183 545 1.0E-15
sp|A9VM74|MENE_BACWK 2-succinylbenzoate--CoA ligase OS=Bacillus weihenstephanensis (strain KBAB4) GN=menE PE=3 SV=1 183 547 1.0E-15
sp|A8AP56|AAS_CITK8 Bifunctional protein Aas OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=aas PE=3 SV=1 181 539 1.0E-15
sp|Q7F1X5|4CLL5_ORYSJ 4-coumarate--CoA ligase-like 5 OS=Oryza sativa subsp. japonica GN=4CLL5 PE=2 SV=1 81 548 1.0E-15
sp|Q9LQS1|AAE8_ARATH Probable acyl-activating enzyme 8 OS=Arabidopsis thaliana GN=AAE8 PE=2 SV=1 194 542 2.0E-15
sp|A7GU88|MENE_BACCN 2-succinylbenzoate--CoA ligase OS=Bacillus cytotoxicus (strain DSM 22905 / CIP 110041 / 391-98 / NVH 391-98) GN=menE PE=3 SV=1 198 539 2.0E-15
sp|Q68CK6|ACS2B_HUMAN Acyl-coenzyme A synthetase ACSM2B, mitochondrial OS=Homo sapiens GN=ACSM2B PE=1 SV=2 81 548 2.0E-15
sp|B5XUP2|AAS_KLEP3 Bifunctional protein Aas OS=Klebsiella pneumoniae (strain 342) GN=aas PE=3 SV=1 173 545 2.0E-15
sp|P27095|ACSA_METCN Acetyl-coenzyme A synthetase OS=Methanosaeta concilii GN=acsA PE=1 SV=1 48 552 2.0E-15
sp|Q9LPK7|AEE10_ARATH Probable acyl-activating enzyme 10 OS=Arabidopsis thaliana GN=AEE10 PE=2 SV=1 201 539 2.0E-15
sp|Q6HC29|MENE_BACHK 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis subsp. konkukian (strain 97-27) GN=menE PE=3 SV=1 183 547 2.0E-15
sp|B7JDD6|MENE_BACC0 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain AH820) GN=menE PE=3 SV=1 183 547 2.0E-15
sp|P0C7M7|ACSM4_HUMAN Acyl-coenzyme A synthetase ACSM4, mitochondrial OS=Homo sapiens GN=ACSM4 PE=2 SV=1 201 542 2.0E-15
sp|O94049|ACS1_CANAX Acetyl-coenzyme A synthetase 1 OS=Candida albicans GN=ACS1 PE=3 SV=1 39 549 3.0E-15
sp|Q8EYG2|ACSA_LEPIN Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar Lai (strain 56601) GN=acsA PE=3 SV=1 81 547 3.0E-15
sp|P46450|LCFA_HAEIN Long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=fadD PE=3 SV=1 241 542 3.0E-15
sp|Q632I5|MENE_BACCZ 2-succinylbenzoate--CoA ligase OS=Bacillus cereus (strain ZK / E33L) GN=menE PE=3 SV=1 183 547 3.0E-15
sp|Q72LY9|ACSA_LEPIC Acetyl-coenzyme A synthetase OS=Leptospira interrogans serogroup Icterohaemorrhagiae serovar copenhageni (strain Fiocruz L1-130) GN=acsA PE=3 SV=1 81 547 3.0E-15
sp|Q336M7|4CLL2_ORYSJ 4-coumarate--CoA ligase-like 2 OS=Oryza sativa subsp. japonica GN=4CLL2 PE=3 SV=3 193 467 4.0E-15
sp|Q81K97|MENE_BACAN 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis GN=menE PE=3 SV=1 183 547 4.0E-15
sp|C3LB87|MENE_BACAC 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain CDC 684 / NRRL 3495) GN=menE PE=3 SV=1 183 547 4.0E-15
sp|C3PCK3|MENE_BACAA 2-succinylbenzoate--CoA ligase OS=Bacillus anthracis (strain A0248) GN=menE PE=3 SV=1 183 547 4.0E-15
sp|Q53FZ2|ACSM3_HUMAN Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Homo sapiens GN=ACSM3 PE=1 SV=2 193 548 5.0E-15
sp|Q8BGA8|ACSM5_MOUSE Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Mus musculus GN=Acsm5 PE=1 SV=1 201 545 5.0E-15
sp|A0RK73|MENE_BACAH 2-succinylbenzoate--CoA ligase OS=Bacillus thuringiensis (strain Al Hakam) GN=menE PE=3 SV=1 183 547 5.0E-15
sp|O60011|ACS1_KLULA Acetyl-coenzyme A synthetase 1 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS1 PE=3 SV=2 197 550 5.0E-15
sp|Q0AAW0|ACSA_ALKEH Acetyl-coenzyme A synthetase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=acsA PE=3 SV=1 81 547 5.0E-15
sp|Q8P3L1|ACSA_XANCP Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=acsA PE=3 SV=1 185 547 8.0E-15
sp|Q4UP35|ACSA_XANC8 Acetyl-coenzyme A synthetase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=acsA PE=3 SV=1 185 547 8.0E-15
sp|Q4R4Z9|ACSF2_MACFA Acyl-CoA synthetase family member 2, mitochondrial OS=Macaca fascicularis GN=ACSF2 PE=2 SV=1 201 549 8.0E-15
sp|Q8PF09|ACSA_XANAC Acetyl-coenzyme A synthetase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=acsA PE=3 SV=1 185 547 8.0E-15
sp|Q5REV5|ACSM3_PONAB Acyl-coenzyme A synthetase ACSM3, mitochondrial OS=Pongo abelii GN=ACSM3 PE=2 SV=1 193 548 8.0E-15
sp|B2HHZ8|FAC17_MYCMM Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD17 PE=3 SV=1 194 546 9.0E-15
sp|Q08AH1|ACSM1_HUMAN Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Homo sapiens GN=ACSM1 PE=1 SV=1 194 548 1.0E-14
sp|Q5HNB2|MENE_STAEQ 2-succinylbenzoate--CoA ligase OS=Staphylococcus epidermidis (strain ATCC 35984 / RP62A) GN=menE PE=3 SV=1 192 542 1.0E-14
sp|Q71YZ5|MENE_LISMF 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serotype 4b (strain F2365) GN=menE PE=3 SV=1 198 548 1.0E-14
sp|Q9LQ12|4CLL1_ARATH 4-coumarate--CoA ligase-like 1 OS=Arabidopsis thaliana GN=4CLL1 PE=1 SV=1 194 542 1.0E-14
sp|Q8K0L3|ACSM2_MOUSE Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Mus musculus GN=Acsm2 PE=1 SV=1 201 545 1.0E-14
sp|Q8DKH2|ACSA_THEEB Acetyl-coenzyme A synthetase OS=Thermosynechococcus elongatus (strain BP-1) GN=acsA PE=3 SV=1 48 542 1.0E-14
sp|B1JQC1|AAS_YERPY Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=aas PE=3 SV=1 83 547 2.0E-14
sp|Q667F1|AAS_YERPS Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=aas PE=3 SV=1 83 547 2.0E-14
sp|B2JZ75|AAS_YERPB Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=aas PE=3 SV=1 83 547 2.0E-14
sp|A7FFD1|AAS_YERP3 Bifunctional protein Aas OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=aas PE=3 SV=1 83 547 2.0E-14
sp|Q9SS00|AAE12_ARATH Probable acyl-activating enzyme 12, peroxisomal OS=Arabidopsis thaliana GN=AAE12 PE=2 SV=1 191 545 2.0E-14
sp|Q53005|4HBCL_RHOPA 4-hydroxybenzoate--CoA/benzoate--CoA ligase OS=Rhodopseudomonas palustris (strain ATCC BAA-98 / CGA009) GN=hbaA PE=1 SV=1 193 542 2.0E-14
sp|A4WE11|AAS_ENT38 Bifunctional protein Aas OS=Enterobacter sp. (strain 638) GN=aas PE=3 SV=1 193 557 2.0E-14
sp|Q2NXE2|ACSA_XANOM Acetyl-coenzyme A synthetase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=acsA PE=3 SV=1 185 547 3.0E-14
sp|A0L576|ACSA_MAGMM Acetyl-coenzyme A synthetase OS=Magnetococcus marinus (strain ATCC BAA-1437 / JCM 17883 / MC-1) GN=acsA PE=3 SV=1 34 547 3.0E-14
sp|Q89WV5|ACSA_BRADU Acetyl-coenzyme A synthetase OS=Bradyrhizobium diazoefficiens (strain JCM 10833 / IAM 13628 / NBRC 14792 / USDA 110) GN=acsA PE=1 SV=2 1 547 3.0E-14
sp|O93730|ACSA_PYRAE Acetyl-coenzyme A synthetase OS=Pyrobaculum aerophilum (strain ATCC 51768 / IM2 / DSM 7523 / JCM 9630 / NBRC 100827) GN=acsA PE=3 SV=2 81 542 3.0E-14
sp|P58730|MENE_LISMO 2-succinylbenzoate--CoA ligase OS=Listeria monocytogenes serovar 1/2a (strain ATCC BAA-679 / EGD-e) GN=menE PE=3 SV=2 198 548 4.0E-14
sp|A4TLD3|AAS_YERPP Bifunctional protein Aas OS=Yersinia pestis (strain Pestoides F) GN=aas PE=3 SV=1 83 547 4.0E-14
sp|A9R2S1|AAS_YERPG Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Angola) GN=aas PE=3 SV=1 83 547 4.0E-14
sp|Q9L9F6|NOVL_STRNV 8-demethylnovobiocic acid synthase OS=Streptomyces niveus GN=novL PE=1 SV=1 191 545 4.0E-14
sp|P9WQ37|FAC13_MYCTU Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD13 PE=1 SV=1 193 548 4.0E-14
sp|P9WQ36|FAC13_MYCTO Long-chain-fatty-acid--CoA ligase FadD13 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD13 PE=3 SV=1 193 548 4.0E-14
sp|Q8NJN3|ACS2_CANAL Acetyl-coenzyme A synthetase 2 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) GN=ACS2 PE=3 SV=2 193 547 5.0E-14
sp|Q8VCW8|ACSF2_MOUSE Acyl-CoA synthetase family member 2, mitochondrial OS=Mus musculus GN=Acsf2 PE=1 SV=1 201 549 6.0E-14
sp|P0C063|GRSB_ANEMI Gramicidin S synthase 2 OS=Aneurinibacillus migulanus GN=grsB PE=3 SV=2 189 542 7.0E-14
sp|Q9SS01|AAE20_ARATH Benzoate--CoA ligase, peroxisomal OS=Arabidopsis thaliana GN=AAE20 PE=1 SV=1 84 545 7.0E-14
sp|Q55404|ACSA_SYNY3 Acetyl-coenzyme A synthetase OS=Synechocystis sp. (strain PCC 6803 / Kazusa) GN=acsA PE=3 SV=1 19 542 8.0E-14
sp|O05598|Y1013_MYCTU Putative ligase Rv1013 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=pks16 PE=1 SV=2 168 544 8.0E-14
sp|Q499N5|ACSF2_RAT Acyl-CoA synthetase family member 2, mitochondrial OS=Rattus norvegicus GN=Acsf2 PE=2 SV=1 201 549 9.0E-14
sp|A0B8F1|ACSA_METTP Acetyl-coenzyme A synthetase OS=Methanosaeta thermophila (strain DSM 6194 / JCM 14653 / NBRC 101360 / PT) GN=acsA PE=1 SV=1 190 552 1.0E-13
sp|P36333|ACSA_PENCH Acetyl-coenzyme A synthetase OS=Penicillium chrysogenum GN=facA PE=3 SV=1 52 549 1.0E-13
sp|P0C064|GRSB_BREBE Gramicidin S synthase 2 OS=Brevibacillus brevis GN=grsB PE=1 SV=2 189 542 1.0E-13
sp|P28812|Y3568_PSEAE Uncharacterized protein PA3568 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=PA3568 PE=3 SV=2 84 547 1.0E-13
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 191 620 2.0E-13
sp|Q91VA0|ACSM1_MOUSE Acyl-coenzyme A synthetase ACSM1, mitochondrial OS=Mus musculus GN=Acsm1 PE=1 SV=1 191 548 2.0E-13
sp|Q27549|ACSA_CRYPV Acetyl-coenzyme A synthetase OS=Cryptosporidium parvum GN=ACS PE=3 SV=1 113 547 2.0E-13
sp|Q9CMW1|ACSA_PASMU Acetyl-coenzyme A synthetase OS=Pasteurella multocida (strain Pm70) GN=acsA PE=3 SV=1 21 542 2.0E-13
sp|Q96CM8|ACSF2_HUMAN Acyl-CoA synthetase family member 2, mitochondrial OS=Homo sapiens GN=ACSF2 PE=1 SV=2 201 549 2.0E-13
sp|Q12MK0|ACSA_SHEDO Acetyl-coenzyme A synthetase OS=Shewanella denitrificans (strain OS217 / ATCC BAA-1090 / DSM 15013) GN=acsA PE=3 SV=1 54 547 2.0E-13
sp|Q01576|ACSA_PHYB8 Acetyl-coenzyme A synthetase OS=Phycomyces blakesleeanus (strain ATCC 8743b / FGSC 10004 / NBRC 33097 / NRRL 1555) GN=facA PE=2 SV=1 185 547 3.0E-13
sp|Q1AXQ5|ACSA_RUBXD Acetyl-coenzyme A synthetase OS=Rubrobacter xylanophilus (strain DSM 9941 / NBRC 16129) GN=acsA PE=3 SV=1 52 542 3.0E-13
sp|Q74RZ6|AAS_YERPE Bifunctional protein Aas OS=Yersinia pestis GN=aas PE=3 SV=2 83 547 3.0E-13
sp|Q1CAS8|AAS_YERPA Bifunctional protein Aas OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=aas PE=3 SV=1 83 547 3.0E-13
sp|A1W1D6|ACSA_CAMJJ Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:23/36 (strain 81-176) GN=acsA PE=3 SV=1 81 542 4.0E-13
sp|Q9PMD2|ACSA_CAMJE Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:2 (strain ATCC 700819 / NCTC 11168) GN=acsA PE=3 SV=1 81 542 4.0E-13
sp|A8FNJ7|ACSA_CAMJ8 Acetyl-coenzyme A synthetase OS=Campylobacter jejuni subsp. jejuni serotype O:6 (strain 81116 / NCTC 11828) GN=acsA PE=3 SV=1 81 542 4.0E-13
sp|O13440|ACSA_COPCI Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea GN=ACS-1 PE=2 SV=1 186 547 4.0E-13
sp|B8FIN2|ACSA_DESAA Acetyl-coenzyme A synthetase OS=Desulfatibacillum alkenivorans (strain AK-01) GN=acsA PE=3 SV=1 4 547 5.0E-13
sp|A4WJG1|ACSA_PYRAR Acetyl-coenzyme A synthetase OS=Pyrobaculum arsenaticum (strain DSM 13514 / JCM 11321) GN=acsA PE=3 SV=1 81 542 5.0E-13
sp|P16929|ACSA_NEUCR Acetyl-coenzyme A synthetase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=acu-5 PE=2 SV=2 52 547 5.0E-13
sp|P19409|BAIB_CLOSV Bile acid-coenzyme A ligase OS=Clostridium scindens (strain JCM 10418 / VPI 12708) GN=baiB PE=1 SV=1 38 542 6.0E-13
sp|O70490|ACSM2_RAT Acyl-coenzyme A synthetase ACSM2, mitochondrial OS=Rattus norvegicus GN=Acsm2 PE=2 SV=2 201 548 6.0E-13
sp|Q9SEY5|AAE2_ARATH Probable acyl-activating enzyme 2 OS=Arabidopsis thaliana GN=AAE2 PE=2 SV=1 201 548 9.0E-13
sp|A8PDE3|ACSA_COPC7 Acetyl-coenzyme A synthetase OS=Coprinopsis cinerea (strain Okayama-7 / 130 / ATCC MYA-4618 / FGSC 9003) GN=ACS-1 PE=3 SV=1 186 547 1.0E-12
sp|Q8GQN9|BCLA_THAAR Benzoate--CoA ligase OS=Thauera aromatica GN=bclA PE=1 SV=1 182 545 1.0E-12
sp|Q6AYT9|ACSM5_RAT Acyl-coenzyme A synthetase ACSM5, mitochondrial OS=Rattus norvegicus GN=Acsm5 PE=2 SV=1 201 545 1.0E-12
sp|Q84HC5|NCSB2_STRCZ 2-hydroxy-7-methoxy-5-methyl-1-naphthoate--CoA ligase OS=Streptomyces carzinostaticus GN=ncsB2 PE=1 SV=1 184 539 2.0E-12
sp|O53551|FAC17_MYCTU Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD17 PE=1 SV=1 188 546 2.0E-12
sp|Q7TWC5|FAC17_MYCBO Long-chain-fatty-acid--CoA ligase FadD17 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD17 PE=3 SV=1 188 546 2.0E-12
sp|A0LG91|ACSA_SYNFM Acetyl-coenzyme A synthetase OS=Syntrophobacter fumaroxidans (strain DSM 10017 / MPOB) GN=acsA PE=3 SV=1 60 547 2.0E-12
sp|Q7MGU3|ACSA_VIBVY Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain YJ016) GN=acsA PE=3 SV=2 4 547 2.0E-12
sp|Q5R9G9|ACSF2_PONAB Acyl-CoA synthetase family member 2, mitochondrial OS=Pongo abelii GN=ACSF2 PE=2 SV=1 201 549 3.0E-12
sp|Q9KV59|ACSA_VIBCH Acetyl-coenzyme A synthetase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=acsA PE=3 SV=2 52 547 3.0E-12
sp|Q17QJ1|ACSF2_BOVIN Acyl-CoA synthetase family member 2, mitochondrial OS=Bos taurus GN=ACSF2 PE=2 SV=1 201 549 3.0E-12
sp|Q8DCZ9|ACSA_VIBVU Acetyl-coenzyme A synthetase OS=Vibrio vulnificus (strain CMCP6) GN=acsA PE=3 SV=1 50 547 3.0E-12
sp|B2VFS7|AAS_ERWT9 Bifunctional protein Aas OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=aas PE=3 SV=1 181 539 3.0E-12
sp|B0SRX5|ACSA_LEPBP Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / ATCC 23582 / Paris) GN=acsA PE=3 SV=1 50 547 4.0E-12
sp|B0S8X7|ACSA_LEPBA Acetyl-coenzyme A synthetase OS=Leptospira biflexa serovar Patoc (strain Patoc 1 / Ames) GN=acsA PE=3 SV=1 50 547 4.0E-12
sp|A0R3D6|Y5435_MYCS2 Putative ligase MSMEG_5435/MSMEI_5285 OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=MSMEG_5435 PE=1 SV=1 168 544 4.0E-12
sp|C0SPB0|YTCI_BACSU Uncharacterized acyl--CoA ligase YtcI OS=Bacillus subtilis (strain 168) GN=ytcI PE=3 SV=1 193 548 4.0E-12
sp|Q9Y7B5|ACS2_KLULA Acetyl-coenzyme A synthetase 2 OS=Kluyveromyces lactis (strain ATCC 8585 / CBS 2359 / DSM 70799 / NBRC 1267 / NRRL Y-1140 / WM37) GN=ACS2 PE=3 SV=2 135 547 7.0E-12
sp|C6DE43|AAS_PECCP Bifunctional protein Aas OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=aas PE=3 SV=1 82 472 8.0E-12
sp|Q6LLZ1|ACSA_PHOPR Acetyl-coenzyme A synthetase OS=Photobacterium profundum GN=acsA PE=3 SV=1 185 547 8.0E-12
sp|Q6BS00|ACS2_DEBHA Acetyl-coenzyme A synthetase 2 OS=Debaryomyces hansenii (strain ATCC 36239 / CBS 767 / JCM 1990 / NBRC 0083 / IGC 2968) GN=ACS2 PE=3 SV=1 193 547 1.0E-11
sp|P13129|LUCI_LUCCR Luciferin 4-monooxygenase OS=Luciola cruciata PE=1 SV=1 193 539 1.0E-11
sp|Q9PB89|ACSA_XYLFA Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain 9a5c) GN=acsA PE=3 SV=1 21 547 1.0E-11
sp|Q0VSR6|ACSA_ALCBS Acetyl-coenzyme A synthetase OS=Alcanivorax borkumensis (strain ATCC 700651 / DSM 11573 / NCIMB 13689 / SK2) GN=acsA PE=3 SV=1 52 547 1.0E-11
sp|Q9A2I0|ACSA_CAUCR Acetyl-coenzyme A synthetase OS=Caulobacter crescentus (strain ATCC 19089 / CB15) GN=acsA PE=3 SV=1 81 547 1.0E-11
sp|P80436|TRS1_STRTI Triostin synthetase I OS=Streptomyces triostinicus GN=trsA PE=1 SV=2 194 545 1.0E-11
sp|Q96VC7|ACS2_ZYGBA Acetyl-coenzyme A synthetase 2 OS=Zygosaccharomyces bailii GN=ACS2 PE=3 SV=1 81 547 2.0E-11
sp|A1JPF0|AAS_YERE8 Bifunctional protein Aas OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=aas PE=3 SV=1 85 547 2.0E-11
sp|Q1H0J2|ACSA_METFK Acetyl-coenzyme A synthetase OS=Methylobacillus flagellatus (strain KT / ATCC 51484 / DSM 6875) GN=acsA PE=3 SV=1 21 542 2.0E-11
sp|Q6D107|AAS_PECAS Bifunctional protein Aas OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=aas PE=3 SV=1 82 472 2.0E-11
sp|P9WQ61|FAA22_MYCTU p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD22 PE=1 SV=1 193 548 2.0E-11
sp|P9WQ60|FAA22_MYCTO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD22 PE=3 SV=1 193 548 2.0E-11
sp|Q7TXK7|FAA22_MYCBO p-hydroxybenzoic acid--AMP ligase FadD22 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD22 PE=1 SV=1 193 548 2.0E-11
sp|P16928|ACSA_EMENI Acetyl-coenzyme A synthetase OS=Emericella nidulans (strain FGSC A4 / ATCC 38163 / CBS 112.46 / NRRL 194 / M139) GN=facA PE=2 SV=2 52 549 3.0E-11
sp|Q9SFW5|AEE21_ARATH Probable acyl-activating enzyme 21 OS=Arabidopsis thaliana GN=AEE21 PE=3 SV=1 189 463 3.0E-11
sp|Q27757|LUCI_PHOPE Luciferin 4-monooxygenase OS=Photuris pensylvanica PE=2 SV=2 185 542 3.0E-11
sp|O07619|YHFT_BACSU Uncharacterized acyl--CoA ligase YhfT OS=Bacillus subtilis (strain 168) GN=yhfT PE=2 SV=1 201 549 3.0E-11
sp|A4YK73|ACSA_BRASO Acetyl-coenzyme A synthetase OS=Bradyrhizobium sp. (strain ORS278) GN=acsA PE=3 SV=1 81 547 3.0E-11
sp|Q88EH6|ACSA1_PSEPK Acetyl-coenzyme A synthetase 1 OS=Pseudomonas putida (strain KT2440) GN=acsA1 PE=3 SV=1 197 547 4.0E-11
sp|Q9VP61|ACSA_DROME Acetyl-coenzyme A synthetase OS=Drosophila melanogaster GN=AcCoAS PE=2 SV=1 51 547 5.0E-11
sp|P31686|4CL1_SOYBN 4-coumarate--CoA ligase 1 (Fragment) OS=Glycine max PE=2 SV=1 289 550 5.0E-11
sp|Q6FXI2|ACS2_CANGA Acetyl-coenzyme A synthetase 2 OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ACS2 PE=3 SV=1 81 547 5.0E-11
sp|A0R5G1|ACSA_MYCS2 Acetyl-coenzyme A synthetase OS=Mycobacterium smegmatis (strain ATCC 700084 / mc(2)155) GN=acsA PE=3 SV=1 56 542 6.0E-11
sp|Q750T7|ACS2_ASHGO Acetyl-coenzyme A synthetase 2 OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ACS2 PE=3 SV=1 193 547 6.0E-11
sp|Q99PU5|ACBG1_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Mus musculus GN=Acsbg1 PE=1 SV=1 343 466 7.0E-11
sp|O30408|TYCB_BREPA Tyrocidine synthase 2 OS=Brevibacillus parabrevis GN=tycB PE=3 SV=1 189 553 7.0E-11
sp|Q26304|LUCI_LUCMI Luciferin 4-monooxygenase OS=Luciola mingrelica PE=1 SV=1 195 539 8.0E-11
sp|Q9I558|ACSA1_PSEAE Acetyl-coenzyme A synthetase 1 OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=acsA1 PE=3 SV=1 193 547 8.0E-11
sp|Q87C00|ACSA_XYLFT Acetyl-coenzyme A synthetase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=acsA PE=3 SV=1 21 547 8.0E-11
sp|A7HSR8|ACSA_PARL1 Acetyl-coenzyme A synthetase OS=Parvibaculum lavamentivorans (strain DS-1 / DSM 13023 / NCIMB 13966) GN=acsA PE=3 SV=1 81 547 1.0E-10
sp|Q3SLF4|ACSA_THIDA Acetyl-coenzyme A synthetase OS=Thiobacillus denitrificans (strain ATCC 25259) GN=acsA PE=3 SV=1 15 542 1.0E-10
sp|A7IFD4|ACSA_XANP2 Acetyl-coenzyme A synthetase OS=Xanthobacter autotrophicus (strain ATCC BAA-1158 / Py2) GN=acsA PE=3 SV=1 50 547 1.0E-10
sp|Q924N5|ACBG1_RAT Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Rattus norvegicus GN=Acsbg1 PE=1 SV=1 343 466 1.0E-10
sp|P44446|LCFH_HAEIN Putative long-chain-fatty-acid--CoA ligase OS=Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) GN=HI_0002 PE=3 SV=1 191 479 1.0E-10
sp|P59872|ACSA_RHOBA Acetyl-coenzyme A synthetase OS=Rhodopirellula baltica (strain DSM 10527 / NCIMB 13988 / SH1) GN=acsA PE=3 SV=1 55 542 1.0E-10
sp|A6VZN8|ACSA_MARMS Acetyl-coenzyme A synthetase OS=Marinomonas sp. (strain MWYL1) GN=acsA PE=3 SV=1 186 547 1.0E-10
sp|Q6MNF1|ACSA_BDEBA Acetyl-coenzyme A synthetase OS=Bdellovibrio bacteriovorus (strain ATCC 15356 / DSM 50701 / NCIB 9529 / HD100) GN=acsA PE=3 SV=1 50 547 2.0E-10
sp|Q8VZF1|AEE7_ARATH Acetate/butyrate--CoA ligase AAE7, peroxisomal OS=Arabidopsis thaliana GN=AAE7 PE=1 SV=1 201 550 2.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 194 552 2.0E-10
sp|Q14DH7|ACSS3_MOUSE Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Mus musculus GN=Acss3 PE=1 SV=2 198 546 3.0E-10
sp|P40871|DHBE_BACSU 2,3-dihydroxybenzoate-AMP ligase OS=Bacillus subtilis (strain 168) GN=dhbE PE=1 SV=2 185 549 3.0E-10
sp|Q2KHW5|ACBG1_BOVIN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Bos taurus GN=ACSBG1 PE=2 SV=1 343 468 4.0E-10
sp|O07899|VIBE_VIBCH Vibriobactin-specific 2,3-dihydroxybenzoate-AMP ligase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=vibE PE=3 SV=1 389 549 4.0E-10
sp|Q8UBV5|ACSA_AGRFC Acetyl-coenzyme A synthetase OS=Agrobacterium fabrum (strain C58 / ATCC 33970) GN=acsA PE=3 SV=2 4 547 5.0E-10
sp|Q98ET8|ACSA_RHILO Acetyl-coenzyme A synthetase OS=Rhizobium loti (strain MAFF303099) GN=acsA PE=3 SV=1 185 547 5.0E-10
sp|P86832|CBCL2_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA2 PE=1 SV=1 193 466 6.0E-10
sp|P86831|CBCL1_ARTSP 4-chlorobenzoate--CoA ligase OS=Arthrobacter sp. GN=fcbA1 PE=1 SV=1 193 466 6.0E-10
sp|Q8XBV3|ENTE_ECO57 Enterobactin synthase component E OS=Escherichia coli O157:H7 GN=entE PE=3 SV=1 386 550 6.0E-10
sp|B2IB12|ACSA_BEII9 Acetyl-coenzyme A synthetase OS=Beijerinckia indica subsp. indica (strain ATCC 9039 / DSM 1715 / NCIB 8712) GN=acsA PE=3 SV=1 183 547 6.0E-10
sp|P10378|ENTE_ECOLI Enterobactin synthase component E OS=Escherichia coli (strain K12) GN=entE PE=1 SV=3 386 550 6.0E-10
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 194 547 8.0E-10
sp|A8AN29|ACSA_CITK8 Acetyl-coenzyme A synthetase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=acs PE=3 SV=1 185 547 8.0E-10
sp|A4SJM6|ACSA_AERS4 Acetyl-coenzyme A synthetase OS=Aeromonas salmonicida (strain A449) GN=acsA PE=3 SV=1 186 547 8.0E-10
sp|A7MPJ7|ACSA_CROS8 Acetyl-coenzyme A synthetase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=acs PE=3 SV=1 176 547 8.0E-10
sp|P9WQ55|FAD10_MYCTU Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD10 PE=1 SV=1 387 542 8.0E-10
sp|P9WQ54|FAD10_MYCTO Putative fatty-acid--CoA ligase FadD10 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD10 PE=4 SV=1 387 542 8.0E-10
sp|A6WXV8|ACSA_OCHA4 Acetyl-coenzyme A synthetase OS=Ochrobactrum anthropi (strain ATCC 49188 / DSM 6882 / NCTC 12168) GN=acsA PE=3 SV=1 4 547 9.0E-10
sp|B2U6V1|ACSA_RALPJ Acetyl-coenzyme A synthetase OS=Ralstonia pickettii (strain 12J) GN=acsA PE=3 SV=1 197 542 1.0E-09
sp|Q96GR2|ACBG1_HUMAN Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Homo sapiens GN=ACSBG1 PE=2 SV=2 343 466 1.0E-09
sp|Q9C9G2|AEE22_ARATH Probable acyl-activating enzyme 22 OS=Arabidopsis thaliana GN=AEE22 PE=3 SV=1 293 545 1.0E-09
sp|Q8XY11|ACSA_RALSO Acetyl-coenzyme A synthetase OS=Ralstonia solanacearum (strain GMI1000) GN=acsA PE=3 SV=1 197 542 2.0E-09
sp|Q885K7|ACSA_PSESM Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=acsA PE=3 SV=1 197 547 2.0E-09
sp|B1ZB59|ACSA_METPB Acetyl-coenzyme A synthetase OS=Methylobacterium populi (strain ATCC BAA-705 / NCIMB 13946 / BJ001) GN=acsA PE=3 SV=1 85 547 2.0E-09
sp|Q01158|LUCI_LUCLA Luciferin 4-monooxygenase OS=Luciola lateralis PE=2 SV=1 188 539 2.0E-09
sp|Q46Z41|ACSA_CUPPJ Acetyl-coenzyme A synthetase OS=Cupriavidus pinatubonensis (strain JMP 134 / LMG 1197) GN=acsA PE=3 SV=1 197 542 2.0E-09
sp|Q4ZQG8|ACSA_PSEU2 Acetyl-coenzyme A synthetase OS=Pseudomonas syringae pv. syringae (strain B728a) GN=acsA PE=3 SV=1 197 547 2.0E-09
sp|A0KNI2|ACSA_AERHH Acetyl-coenzyme A synthetase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=acsA PE=3 SV=1 21 547 2.0E-09
sp|Q4R4P9|ACBG1_MACFA Long-chain-fatty-acid--CoA ligase ACSBG1 OS=Macaca fascicularis GN=ACSBG1 PE=2 SV=2 343 466 3.0E-09
sp|Q87KU7|ACSA_VIBPA Acetyl-coenzyme A synthetase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=acsA PE=3 SV=1 4 547 3.0E-09
sp|Q48G09|ACSA_PSE14 Acetyl-coenzyme A synthetase OS=Pseudomonas savastanoi pv. phaseolicola (strain 1448A / Race 6) GN=acsA PE=3 SV=1 197 547 3.0E-09
sp|Q88DW6|ACSA2_PSEPK Acetyl-coenzyme A synthetase 2 OS=Pseudomonas putida (strain KT2440) GN=acsA2 PE=3 SV=1 186 547 3.0E-09
sp|Q07VK4|ACSA_RHOP5 Acetyl-coenzyme A synthetase OS=Rhodopseudomonas palustris (strain BisA53) GN=acsA PE=3 SV=1 52 547 3.0E-09
sp|C1D6V9|ACSA_LARHH Acetyl-coenzyme A synthetase OS=Laribacter hongkongensis (strain HLHK9) GN=acsA PE=3 SV=1 85 542 3.0E-09
sp|A1UR36|ACSA_BARBK Acetyl-coenzyme A synthetase OS=Bartonella bacilliformis (strain ATCC 35685 / KC583) GN=acsA PE=3 SV=1 183 547 3.0E-09
sp|B3R1X2|ACSA_CUPTR Acetyl-coenzyme A synthetase OS=Cupriavidus taiwanensis (strain R1 / LMG 19424) GN=acsA PE=3 SV=1 81 542 4.0E-09
sp|A4VKA0|ACSA_PSEU5 Acetyl-coenzyme A synthetase OS=Pseudomonas stutzeri (strain A1501) GN=acsA PE=3 SV=1 52 547 4.0E-09
sp|A9W5V0|ACSA_METEP Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain PA1) GN=acsA PE=3 SV=1 2 547 4.0E-09
sp|Q8FAY8|ACSA_ECOL6 Acetyl-coenzyme A synthetase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=acs PE=3 SV=1 193 547 5.0E-09
sp|C0RF62|ACSA_BRUMB Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 2 (strain ATCC 23457) GN=acsA PE=3 SV=1 4 547 5.0E-09
sp|Q99NB1|ACS2L_MOUSE Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Mus musculus GN=Acss1 PE=1 SV=1 193 547 5.0E-09
sp|P27550|ACSA_ECOLI Acetyl-coenzyme A synthetase OS=Escherichia coli (strain K12) GN=acs PE=1 SV=2 193 547 5.0E-09
sp|Q3IFM6|ACSA_PSEHT Acetyl-coenzyme A synthetase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=acsA PE=3 SV=1 53 547 6.0E-09
sp|A6UED8|ACSA_SINMW Acetyl-coenzyme A synthetase OS=Sinorhizobium medicae (strain WSM419) GN=acsA PE=3 SV=1 4 564 6.0E-09
sp|P59871|ACSA_MYCBO Acetyl-coenzyme A synthetase OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=acsA PE=3 SV=1 197 542 8.0E-09
sp|Q8KBY0|ACSA_CHLTE Acetyl-coenzyme A synthetase OS=Chlorobium tepidum (strain ATCC 49652 / DSM 12025 / NBRC 103806 / TLS) GN=acsA PE=3 SV=2 197 542 9.0E-09
sp|P9WQD1|ACSA_MYCTU Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=acsA PE=1 SV=1 197 542 9.0E-09
sp|P9WQD0|ACSA_MYCTO Acetyl-coenzyme A synthetase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=acsA PE=3 SV=1 197 542 9.0E-09
sp|Q8YJ48|ACSA_BRUME Acetyl-coenzyme A synthetase OS=Brucella melitensis biotype 1 (strain 16M / ATCC 23456 / NCTC 10094) GN=acsA PE=3 SV=2 4 547 9.0E-09
sp|Q1QEB6|ACSA_PSYCK Acetyl-coenzyme A synthetase OS=Psychrobacter cryohalolentis (strain K5) GN=acsA PE=3 SV=1 193 542 1.0E-08
sp|Q8FYQ3|ACSA_BRUSU Acetyl-coenzyme A synthetase OS=Brucella suis biovar 1 (strain 1330) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|A9M849|ACSA_BRUC2 Acetyl-coenzyme A synthetase OS=Brucella canis (strain ATCC 23365 / NCTC 10854) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|Q57B76|ACSA_BRUAB Acetyl-coenzyme A synthetase OS=Brucella abortus biovar 1 (strain 9-941) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|Q2YLH5|ACSA_BRUA2 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain 2308) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|B2S7N5|ACSA_BRUA1 Acetyl-coenzyme A synthetase OS=Brucella abortus (strain S19) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|Q54Z60|ACSA_DICDI Acetyl-coenzyme A synthetase OS=Dictyostelium discoideum GN=acsA PE=3 SV=1 183 547 1.0E-08
sp|A9WWT6|ACSA_BRUSI Acetyl-coenzyme A synthetase OS=Brucella suis (strain ATCC 23445 / NCTC 10510) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|Q21LV0|ACSA_SACD2 Acetyl-coenzyme A synthetase OS=Saccharophagus degradans (strain 2-40 / ATCC 43961 / DSM 17024) GN=acsA PE=3 SV=1 85 547 1.0E-08
sp|A5VSF3|ACSA_BRUO2 Acetyl-coenzyme A synthetase OS=Brucella ovis (strain ATCC 25840 / 63/290 / NCTC 10512) GN=acsA PE=3 SV=1 4 547 1.0E-08
sp|A7MB45|ACSS3_BOVIN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Bos taurus GN=ACSS3 PE=2 SV=1 198 546 1.0E-08
sp|Q9H6R3|ACSS3_HUMAN Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Homo sapiens GN=ACSS3 PE=1 SV=1 198 546 1.0E-08
sp|Q9KWA3|ACSA_AGRRH Acetyl-coenzyme A synthetase OS=Agrobacterium rhizogenes GN=acsA PE=3 SV=1 4 547 2.0E-08
sp|A8G8G7|ACSA_SERP5 Acetyl-coenzyme A synthetase OS=Serratia proteamaculans (strain 568) GN=acs PE=3 SV=1 186 547 2.0E-08
sp|P08659|LUCI_PHOPY Luciferin 4-monooxygenase OS=Photinus pyralis PE=1 SV=1 186 539 2.0E-08
sp|A1JIK3|ACSA_YERE8 Acetyl-coenzyme A synthetase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=acs PE=3 SV=1 186 547 2.0E-08
sp|P97849|S27A1_RAT Long-chain fatty acid transport protein 1 OS=Rattus norvegicus GN=Slc27a1 PE=2 SV=1 192 466 2.0E-08
sp|A4TS06|ACSA_YERPP Acetyl-coenzyme A synthetase OS=Yersinia pestis (strain Pestoides F) GN=acs PE=3 SV=1 124 547 2.0E-08
sp|Q1CE37|ACSA_YERPN Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=acs PE=3 SV=1 124 547 2.0E-08
sp|Q8D1G8|ACSA_YERPE Acetyl-coenzyme A synthetase OS=Yersinia pestis GN=acs PE=3 SV=2 124 547 2.0E-08
sp|Q1C0N0|ACSA_YERPA Acetyl-coenzyme A synthetase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=acs PE=3 SV=1 124 547 2.0E-08
sp|P31638|ACSA_CUPNH Acetyl-coenzyme A synthetase OS=Cupriavidus necator (strain ATCC 17699 / H16 / DSM 428 / Stanier 337) GN=acsA PE=3 SV=1 197 542 2.0E-08
sp|Q9RRL7|ACSA_DEIRA Acetyl-coenzyme A synthetase OS=Deinococcus radiodurans (strain ATCC 13939 / DSM 20539 / JCM 16871 / LMG 4051 / NBRC 15346 / NCIMB 9279 / R1 / VKM B-1422) GN=acsA PE=3 SV=1 197 542 2.0E-08
sp|Q5REB8|ACSS3_PONAB Acyl-CoA synthetase short-chain family member 3, mitochondrial OS=Pongo abelii GN=ACSS3 PE=2 SV=1 198 546 2.0E-08
sp|Q9ULC5|ACSL5_HUMAN Long-chain-fatty-acid--CoA ligase 5 OS=Homo sapiens GN=ACSL5 PE=1 SV=1 193 495 2.0E-08
sp|B7KPN8|ACSA_METC4 Acetyl-coenzyme A synthetase OS=Methylobacterium extorquens (strain CM4 / NCIMB 13688) GN=acsA PE=3 SV=1 2 547 3.0E-08
sp|Q8X5T5|ACSA_ECO57 Acetyl-coenzyme A synthetase OS=Escherichia coli O157:H7 GN=acs PE=3 SV=1 193 547 3.0E-08
sp|Q5ZKR7|ACBG2_CHICK Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Gallus gallus GN=ACSBG2 PE=2 SV=2 198 469 3.0E-08
sp|Q7N7A9|AAS_PHOLL Bifunctional protein Aas OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=aas PE=3 SV=1 172 453 3.0E-08
sp|Q8Z1R0|ACSA_SALTI Acetyl-coenzyme A synthetase OS=Salmonella typhi GN=acs PE=3 SV=1 183 547 3.0E-08
sp|Q8ZKF6|ACSA_SALTY Acetyl-coenzyme A synthetase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=acs PE=1 SV=1 193 547 3.0E-08
sp|Q7NSY7|ACSA_CHRVO Acetyl-coenzyme A synthetase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=acsA PE=3 SV=1 193 542 4.0E-08
sp|Q3ZKN0|S27A1_BOVIN Long-chain fatty acid transport protein 1 OS=Bos taurus GN=SLC27A1 PE=2 SV=1 146 463 4.0E-08
sp|Q7TYX8|FAC15_MYCBO Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=fadD15 PE=3 SV=2 392 466 5.0E-08
sp|Q0AFF1|ACSA_NITEC Acetyl-coenzyme A synthetase OS=Nitrosomonas eutropha (strain C91) GN=acsA PE=3 SV=1 197 542 5.0E-08
sp|A9IYZ3|ACSA_BART1 Acetyl-coenzyme A synthetase OS=Bartonella tribocorum (strain CIP 105476 / IBS 506) GN=acsA PE=3 SV=1 4 467 5.0E-08
sp|Q66FM8|ACSA_YERPS Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=acs PE=3 SV=1 124 547 5.0E-08
sp|A7FNG1|ACSA_YERP3 Acetyl-coenzyme A synthetase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=acs PE=3 SV=1 124 547 5.0E-08
sp|P52910|ACS2_YEAST Acetyl-coenzyme A synthetase 2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ACS2 PE=1 SV=1 81 547 5.0E-08
sp|O53521|FAC15_MYCTU Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD15 PE=1 SV=3 392 466 5.0E-08
sp|P25464|ACVS_ACRCH N-(5-amino-5-carboxypentanoyl)-L-cysteinyl-D-valine synthase OS=Acremonium chrysogenum GN=PCBAB PE=1 SV=1 172 526 6.0E-08
sp|A1U2S9|ACSA_MARHV Acetyl-coenzyme A synthetase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=acsA PE=3 SV=1 193 547 6.0E-08
sp|Q39EK2|ACSA_BURL3 Acetyl-coenzyme A synthetase OS=Burkholderia lata (strain ATCC 17760 / LMG 22485 / NCIMB 9086 / R18194 / 383) GN=acsA PE=3 SV=1 84 542 6.0E-08
sp|Q9V3U0|BGML_DROME Long-chain-fatty-acid--CoA ligase bubblegum-like OS=Drosophila melanogaster GN=CG4500 PE=2 SV=1 392 466 7.0E-08
sp|B2HGV4|FAC15_MYCMM Long-chain-fatty-acid--CoA ligase FadD15 OS=Mycobacterium marinum (strain ATCC BAA-535 / M) GN=fadD15 PE=3 SV=1 339 466 7.0E-08
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 170 545 8.0E-08
sp|B2JD61|ACSA_BURP8 Acetyl-coenzyme A synthetase OS=Burkholderia phymatum (strain DSM 17167 / STM815) GN=acsA PE=3 SV=1 58 542 8.0E-08
sp|Q5K4L6|S27A3_HUMAN Long-chain fatty acid transport protein 3 OS=Homo sapiens GN=SLC27A3 PE=2 SV=3 80 553 8.0E-08
sp|Q82SI5|ACSA_NITEU Acetyl-coenzyme A synthetase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=acsA PE=3 SV=1 81 542 8.0E-08
sp|O68007|BACB_BACLI Bacitracin synthase 2 OS=Bacillus licheniformis GN=bacB PE=3 SV=1 194 550 1.0E-07
sp|Q9F7R5|ACSA_PRB01 Acetyl-coenzyme A synthetase OS=Gamma-proteobacterium EBAC31A08 GN=acsA PE=3 SV=1 113 547 1.0E-07
sp|P9WQ39|MENE_MYCTU Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=menE PE=1 SV=1 392 549 1.0E-07
sp|P9WQ38|MENE_MYCTO Probable 2-succinylbenzoate--CoA ligase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=menE PE=3 SV=1 392 549 1.0E-07
sp|Q04747|SRFAB_BACSU Surfactin synthase subunit 2 OS=Bacillus subtilis (strain 168) GN=srfAB PE=1 SV=3 186 547 1.0E-07
sp|B0TPY4|ACSA_SHEHH Acetyl-coenzyme A synthetase OS=Shewanella halifaxensis (strain HAW-EB4) GN=acsA PE=3 SV=1 54 547 1.0E-07
sp|A8H5P1|ACSA_SHEPA Acetyl-coenzyme A synthetase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=acsA PE=3 SV=1 54 547 1.0E-07
sp|Q6FYL4|ACSA_BARQU Acetyl-coenzyme A synthetase OS=Bartonella quintana (strain Toulouse) GN=acsA PE=3 SV=1 186 468 1.0E-07
sp|P78773|ACSA_SCHPO Probable acetyl-coenzyme A synthetase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=SPCC191.02c PE=1 SV=2 182 550 1.0E-07
sp|Q73ZP7|MBTM_MYCPA Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium paratuberculosis (strain ATCC BAA-968 / K-10) GN=mbtM PE=3 SV=1 198 549 1.0E-07
sp|Q1LL27|ACSA_CUPMC Acetyl-coenzyme A synthetase OS=Cupriavidus metallidurans (strain ATCC 43123 / DSM 2839 / NBRC 102507 / CH34) GN=acsA PE=3 SV=1 197 542 2.0E-07
sp|Q2XU92|ACBG2_MOUSE Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Mus musculus GN=Acsbg2 PE=1 SV=1 190 474 2.0E-07
sp|Q084J4|ACSA_SHEFN Acetyl-coenzyme A synthetase OS=Shewanella frigidimarina (strain NCIMB 400) GN=acsA PE=3 SV=1 54 547 2.0E-07
sp|Q60714|S27A1_MOUSE Long-chain fatty acid transport protein 1 OS=Mus musculus GN=Slc27a1 PE=1 SV=1 192 466 2.0E-07
sp|Q91VE0|S27A4_MOUSE Long-chain fatty acid transport protein 4 OS=Mus musculus GN=Slc27a4 PE=1 SV=1 194 553 2.0E-07
sp|Q9NUB1|ACS2L_HUMAN Acetyl-coenzyme A synthetase 2-like, mitochondrial OS=Homo sapiens GN=ACSS1 PE=1 SV=2 193 547 2.0E-07
sp|A3QD52|ACSA_SHELP Acetyl-coenzyme A synthetase OS=Shewanella loihica (strain ATCC BAA-1088 / PV-4) GN=acsA PE=3 SV=1 54 547 2.0E-07
sp|Q9R9J0|MYCB_BACIU Mycosubtilin synthase subunit B OS=Bacillus subtilis GN=mycB PE=3 SV=1 189 539 2.0E-07
sp|Q63NC4|ACSA_BURPS Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain K96243) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|A3NH07|ACSA_BURP6 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 668) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|Q3JH62|ACSA_BURP1 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1710b) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|A3P2K7|ACSA_BURP0 Acetyl-coenzyme A synthetase OS=Burkholderia pseudomallei (strain 1106a) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|A1UWN5|ACSA_BURMS Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain SAVP1) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|Q62AD1|ACSA_BURMA Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain ATCC 23344) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|A2RYW5|ACSA_BURM9 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10229) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|A3MG40|ACSA_BURM7 Acetyl-coenzyme A synthetase OS=Burkholderia mallei (strain NCTC 10247) GN=acsA PE=3 SV=1 84 542 2.0E-07
sp|Q9V3S9|BGM_DROME Very long-chain-fatty-acid--CoA ligase bubblegum OS=Drosophila melanogaster GN=bgm PE=2 SV=1 392 466 3.0E-07
sp|Q7ZYC4|ACBG2_XENLA Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Xenopus laevis GN=acsbg2 PE=2 SV=1 343 466 3.0E-07
sp|Q7MBA6|ACSA_PHOLL Acetyl-coenzyme A synthetase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=acs PE=3 SV=1 193 547 3.0E-07
sp|Q82EL5|ACSA_STRAW Acetyl-coenzyme A synthetase OS=Streptomyces avermitilis (strain ATCC 31267 / DSM 46492 / JCM 5070 / NBRC 14893 / NCIMB 12804 / NRRL 8165 / MA-4680) GN=acsA PE=3 SV=1 49 542 3.0E-07
sp|P9WQ53|FAD11_MYCTU Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=fadD11 PE=3 SV=1 343 469 3.0E-07
sp|P9WQ52|FAD11_MYCTO Putative fatty-acid--CoA ligase fadD11 OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=fadD11 PE=3 SV=1 343 469 3.0E-07
sp|Q9R9J1|MYCA_BACIU Mycosubtilin synthase subunit A OS=Bacillus subtilis GN=mycA PE=3 SV=1 193 559 4.0E-07
sp|Q4WVN4|NRPS8_ASPFU Nonribosomal peptide synthetase 8 OS=Neosartorya fumigata (strain ATCC MYA-4609 / Af293 / CBS 101355 / FGSC A1100) GN=NRPS8 PE=3 SV=1 257 561 4.0E-07
sp|Q554Z5|ACSB_DICDI Acyl-CoA synthetase short-chain family member B, mitochondrial OS=Dictyostelium discoideum GN=aslB PE=3 SV=1 185 549 4.0E-07
sp|A1SZA2|ACSA_PSYIN Acetyl-coenzyme A synthetase OS=Psychromonas ingrahamii (strain 37) GN=acsA PE=3 SV=1 185 547 6.0E-07
sp|Q1XHT8|TRI40_PANTR Tripartite motif-containing protein 40 OS=Pan troglodytes GN=TRIM40 PE=3 SV=1 1567 1614 6.0E-07
sp|P9WQ41|MBTM_MYCTU Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=mbtM PE=1 SV=1 235 549 6.0E-07
sp|P0A4X9|MBTM_MYCBO Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium bovis (strain ATCC BAA-935 / AF2122/97) GN=mbtM PE=3 SV=1 235 549 6.0E-07
sp|Q6PCN7|HLTF_MOUSE Helicase-like transcription factor OS=Mus musculus GN=Hltf PE=1 SV=1 1522 1627 6.0E-07
sp|Q54S31|PEX10_DICDI Peroxisome biogenesis factor 10 OS=Dictyostelium discoideum GN=pex10 PE=3 SV=2 1568 1610 7.0E-07
sp|P9WQ40|MBTM_MYCTO Long-chain-fatty-acid--[acyl-carrier-protein] ligase MbtM OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=mbtM PE=3 SV=1 235 549 8.0E-07
sp|A4G3L8|ACSA_HERAR Acetyl-coenzyme A synthetase OS=Herminiimonas arsenicoxydans GN=acsA PE=3 SV=1 197 542 8.0E-07
sp|Q4L3Q0|VRAA_STAHJ Putative long chain fatty acid-CoA ligase VraA OS=Staphylococcus haemolyticus (strain JCSC1435) GN=vraA PE=3 SV=1 182 542 9.0E-07
sp|Q6P9F5|TRI40_HUMAN Tripartite motif-containing protein 40 OS=Homo sapiens GN=TRIM40 PE=1 SV=3 1567 1614 9.0E-07
sp|A1L1K7|ACBG2_RAT Long-chain-fatty-acid--CoA ligase ACSBG2 OS=Rattus norvegicus GN=Acsbg2 PE=2 SV=1 190 474 1.0E-06
sp|Q53526|DLTA_STRMU D-alanine--poly(phosphoribitol) ligase subunit 1 OS=Streptococcus mutans serotype c (strain ATCC 700610 / UA159) GN=dltA PE=3 SV=4 193 539 1.0E-06
sp|Q95216|HLTF_RABIT Helicase-like transcription factor OS=Oryctolagus cuniculus GN=HLTF PE=1 SV=1 1522 1627 1.0E-06
sp|Q9R1A8|RFWD2_MOUSE E3 ubiquitin-protein ligase RFWD2 OS=Mus musculus GN=Rfwd2 PE=1 SV=2 1563 1625 1.0E-06
sp|O30409|TYCC_BREPA Tyrocidine synthase 3 OS=Brevibacillus parabrevis GN=tycC PE=1 SV=1 193 550 2.0E-06
sp|Q15YI8|ACSA_PSEA6 Acetyl-coenzyme A synthetase OS=Pseudoalteromonas atlantica (strain T6c / ATCC BAA-1087) GN=acsA PE=3 SV=1 186 547 2.0E-06
sp|Q2NR28|ACSA_SODGM Acetyl-coenzyme A synthetase OS=Sodalis glossinidius (strain morsitans) GN=acs PE=3 SV=1 186 547 2.0E-06
sp|Q8LPS1|LACS6_ARATH Long chain acyl-CoA synthetase 6, peroxisomal OS=Arabidopsis thaliana GN=LACS6 PE=1 SV=1 177 464 2.0E-06
sp|Q8NHY2|RFWD2_HUMAN E3 ubiquitin-protein ligase RFWD2 OS=Homo sapiens GN=RFWD2 PE=1 SV=1 1564 1625 2.0E-06
sp|Q14527|HLTF_HUMAN Helicase-like transcription factor OS=Homo sapiens GN=HLTF PE=1 SV=2 1522 1627 2.0E-06
sp|Q8LKS5|LACS7_ARATH Long chain acyl-CoA synthetase 7, peroxisomal OS=Arabidopsis thaliana GN=LACS7 PE=1 SV=2 173 463 2.0E-06
sp|Q7M9Y2|ACSA_WOLSU Acetyl-coenzyme A synthetase OS=Wolinella succinogenes (strain ATCC 29543 / DSM 1740 / LMG 7466 / NCTC 11488 / FDC 602W) GN=acsA PE=3 SV=1 81 542 3.0E-06
sp|P33124|ACSL6_RAT Long-chain-fatty-acid--CoA ligase 6 OS=Rattus norvegicus GN=Acsl6 PE=1 SV=1 193 467 3.0E-06
sp|Q6FMI5|LYS2_CANGA L-2-aminoadipate reductase large subunit OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=LYS2 PE=3 SV=1 629 752 3.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0046872 metal ion binding Yes
GO:0003674 molecular_function No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0043169 cation binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 12 0.45

Transmembrane Domains

Domain # Start End Length
1 816 838 22
2 845 867 22
3 1037 1059 22
4 1302 1324 22
5 1360 1382 22
6 1417 1439 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090280
MSVPLSSLRARALPNDIALGRWIADQLANSSHIGSLLDCLPSTHNPAIFSPEPSQRALTHDQLRTFISTFVLPHS
PTHTPLRPNDRVLVALPNGPLNALALLSVASYHTCAPVNASCTPSELRDDAIRLGAKLILASIDSIERLGLGSLQ
EELGCDVIIAKPHADGPSGMFTMTCLNKQTIFPRSPSRLHELDDLSLVLQTSGTSGRKKVVPYSLRTLVVGAWAV
VQSWSLKEDDVNLNMMPLFHVGGFVRSLCAPILSGGGTIMCSGFDAVAFWDVAIRFGATWYYGAPTVHHAILSSR
PPHVNAMKDSRMRMICNAAGGLLPSLATEMKETFGKAVILPSYGMTECMPIASPPQDYQLERPGCSGIACGPEVS
IRDPFNIDRELPRGSTGAIAVRGFPMFSGYETSPDRSVPLDTSCFSSEGWFDTGDMGYFDSDGYLYITGRSKEII
NKGGEVISPFEIEEAIITAAKDRVKSTLAFTVEHDVLQEAIGVVIVCVSNKPRIGLHQLQDSLRDHLHPSKWPSV
VVYMDDLPKNSTGKAVRINLAKRLGLPSFHDGIPVNRRHFDAQVPSPRASLSESIPCSRVSLTSKGVESLLGRMK
EVNDLALNLSPDGAAELYLSVDSRCLLNSEAFKAIISQEVDGYLVPEVVYLMHGSLSRDMSGEVDFLEARRTSAQ
FASASMSKTESRIRDLVAEILSVDRASITPRSDFFLIGGNSLLLGKLAYHIRKETGIPIGVSSLFNNCTIGEMAA
LVDAEGPKGSFFSVDEKERDPHSDTTSTATFGLEYDYDQEYQVFEKAKARGQTHPLCLITQAIPVLFFYPLKAAL
TWSLLLFTLSYIAQFLDGGFWVKLGTLIAAIIASRMAVRIIAPIIAILFKWLVVGKYQAGTYRMWSVYYLRCWLV
DQSIRSSGKGLFALHPSLTILYYRLLGAKIGKNVFIDPKTKLGEYDMLTFQDGCRVDKSHIRGFCVEREGHFRLD
PINIGKRAVINTYTSISPGAIIPDSAVYGPHASSHDAPFPKSYAIYNRTLSSGPHWLLQVLVAWPLIILVVAIAH
IPWIFCLWLMIQEVQFDTIGLNALEAVIWWFADPRRVAYHTLSRVVRASMTSICQLILGIALKRLMGLNKECRTK
EYTQMMQLRRYINSMILSHELLHDAFSILGAHYEVVSVVYRAMGAKIGKRIYWPGSGVVCQDPELLEIGDDVVFG
SRSEILTNDRLGTKKVVIGSGAMIADRVVLLPGCNVGRRTVMGSGALGKRDTLYEDGSTWMGCENGEAICFGRSD
RDYPEKEVTSTSTPFGRAFYEGKADYWVFPYWFILGSNLAMTAISAAYWSISPVAAALLLRHIHLQFNHTSLFKP
SWYRLGVLYILIAICFIVVLNLQATIAILWAVATKWLVIGERRQGRYEWDKSDYCQRWQLHLSLCRLLYRGYGVG
GILGNLNGSAYIVWFYRSLGATIGKNCALFAGGISGLMTEPDLVEIGDDVSLDDCSVVAHINSRGVFALNHLKIG
NGCALRSGSRLLSGASMEDKSMLCEHTLLVSGDIAESGYAYSGWPAQRQSPEAEVTEPPASPGGQLICPICRQFP
QHAVVTNCGHLFCMRCINQTITNQRRCPICRAPVSRAQLRQIRPSFVASDQDHTQQGHADVT*
Coding >AgabiH97|090280
ATGTCAGTTCCTCTCTCCTCCCTGCGTGCTCGCGCCCTCCCGAACGACATCGCATTGGGTCGCTGGATAGCTGAC
CAACTAGCAAATTCCTCTCACATCGGCTCGCTTTTAGACTGCCTACCTTCTACCCACAACCCCGCTATATTCTCT
CCAGAGCCCTCACAGCGAGCCCTCACACATGACCAACTACGCACATTCATCTCCACATTTGTATTGCCTCATTCT
CCGACGCATACACCCTTAAGACCCAACGACCGTGTTCTCGTCGCCCTTCCAAATGGCCCACTCAACGCTTTGGCT
CTGCTCTCTGTCGCATCCTATCATACATGTGCTCCCGTCAATGCTTCATGTACGCCCAGCGAGCTTAGGGACGAT
GCCATTAGGCTAGGGGCAAAACTTATACTCGCTTCCATCGACTCCATAGAACGACTCGGCTTAGGGTCATTACAA
GAAGAGCTAGGCTGTGACGTTATTATTGCCAAGCCCCATGCTGACGGCCCGTCTGGAATGTTCACAATGACTTGC
TTGAACAAGCAAACAATATTTCCCCGCAGCCCTTCCCGGCTTCATGAACTGGACGATTTATCCCTTGTTCTCCAG
ACTTCTGGAACCAGCGGAAGAAAGAAAGTAGTCCCGTATTCTCTTCGTACATTGGTTGTGGGGGCTTGGGCCGTT
GTTCAATCATGGTCCTTGAAGGAGGATGACGTTAATTTGAATATGATGCCTCTTTTCCATGTCGGCGGGTTTGTA
CGGAGCTTGTGCGCTCCTATTCTTTCTGGGGGCGGTACTATCATGTGCAGTGGGTTTGATGCTGTTGCTTTTTGG
GATGTCGCTATTCGCTTCGGGGCTACTTGGTACTATGGGGCGCCAACTGTACACCACGCTATCTTATCTTCCCGC
CCACCTCATGTCAATGCTATGAAAGACTCACGTATGCGCATGATCTGTAACGCAGCAGGAGGATTGTTACCCTCT
CTTGCGACGGAAATGAAAGAAACTTTTGGGAAAGCCGTAATCCTTCCGTCTTATGGCATGACAGAGTGCATGCCA
ATCGCTTCTCCGCCCCAAGACTATCAGTTAGAACGTCCGGGTTGCTCGGGTATTGCCTGTGGTCCGGAAGTATCT
ATTCGCGACCCGTTTAATATTGACCGTGAATTGCCTCGGGGTAGTACTGGCGCGATCGCTGTCCGCGGTTTTCCA
ATGTTTTCTGGCTATGAAACATCTCCCGATAGAAGCGTGCCTCTAGATACTTCTTGCTTTTCGTCTGAAGGCTGG
TTTGACACAGGAGACATGGGCTATTTTGATTCCGACGGATATCTATACATAACCGGTCGATCAAAGGAGATAATC
AACAAGGGTGGCGAGGTTATATCTCCGTTCGAGATTGAAGAGGCGATTATCACAGCGGCTAAGGATCGTGTCAAG
AGCACACTTGCGTTCACCGTTGAGCACGATGTTCTACAAGAAGCAATAGGGGTTGTAATCGTCTGCGTGTCTAAC
AAGCCACGAATTGGCCTTCATCAGCTGCAAGACAGTCTACGCGATCACCTTCACCCGTCTAAGTGGCCCTCCGTG
GTTGTTTATATGGATGACCTTCCTAAAAACAGCACTGGAAAGGCAGTTCGCATCAACTTAGCAAAGCGTCTTGGT
CTCCCTTCTTTCCATGATGGCATTCCAGTGAACCGACGCCATTTCGACGCGCAGGTCCCCTCACCCCGTGCATCC
TTATCAGAATCGATCCCTTGTTCCCGCGTATCGTTGACTTCAAAAGGAGTGGAATCACTTCTGGGACGTATGAAA
GAAGTCAATGATCTTGCTCTGAATTTATCTCCCGATGGGGCTGCTGAATTATATTTAAGCGTCGATTCCAGGTGT
CTCTTGAACTCAGAGGCATTCAAGGCTATCATTTCCCAGGAAGTTGATGGATACTTGGTACCCGAAGTGGTTTAC
TTGATGCATGGCTCTTTGTCGCGAGACATGAGTGGCGAGGTAGACTTCCTAGAAGCTAGAAGGACGTCTGCACAG
TTTGCTTCCGCTTCAATGTCAAAAACCGAGTCTCGCATCAGAGATCTCGTGGCCGAGATCCTATCGGTGGATCGT
GCTAGTATCACTCCTCGATCAGACTTTTTCCTCATCGGGGGCAATTCACTTCTTCTTGGGAAGCTCGCTTACCAT
ATTCGTAAAGAAACTGGAATACCAATTGGTGTTTCGTCTCTGTTCAACAACTGTACGATTGGCGAGATGGCAGCT
CTCGTAGATGCAGAAGGGCCAAAAGGATCATTTTTCTCGGTAGATGAGAAGGAACGAGATCCTCATTCCGATACG
ACGTCAACAGCAACTTTTGGGCTCGAGTATGATTATGATCAGGAATATCAAGTATTCGAAAAGGCAAAGGCGCGC
GGTCAGACCCATCCTCTTTGTTTAATCACTCAGGCAATCCCAGTTTTATTCTTCTATCCGCTGAAGGCCGCACTT
ACTTGGTCCCTCCTACTTTTCACGTTATCTTATATCGCGCAATTTCTTGATGGGGGTTTTTGGGTGAAACTCGGC
ACCCTAATAGCCGCTATCATTGCTTCGAGAATGGCTGTCAGGATTATCGCTCCAATCATTGCTATATTGTTCAAA
TGGCTGGTGGTGGGCAAGTATCAGGCGGGAACATATCGCATGTGGTCTGTCTACTATCTTCGGTGTTGGTTAGTA
GATCAAAGTATAAGATCCTCTGGCAAAGGACTTTTCGCTCTTCACCCTTCTTTGACGATCTTATATTATCGACTA
CTCGGTGCCAAGATAGGCAAGAACGTGTTCATCGATCCTAAAACTAAGCTAGGAGAATATGATATGTTAACATTT
CAGGATGGATGCCGCGTTGATAAGTCCCATATAAGGGGATTCTGTGTGGAAAGAGAGGGACATTTCCGACTGGAT
CCTATCAACATCGGGAAACGTGCTGTCATCAACACCTATACTTCAATCTCTCCCGGAGCTATCATCCCCGACAGT
GCCGTTTACGGTCCCCACGCATCTTCTCATGATGCACCGTTTCCCAAATCATACGCTATATACAATCGTACACTG
AGCTCGGGACCTCATTGGCTTCTTCAAGTTTTAGTTGCTTGGCCACTCATTATCTTAGTCGTGGCAATAGCTCAT
ATCCCATGGATATTTTGCCTGTGGCTCATGATCCAGGAAGTTCAATTCGATACGATCGGCTTGAATGCTCTTGAG
GCAGTCATCTGGTGGTTCGCTGATCCGCGTCGAGTTGCATACCATACGTTATCCCGAGTTGTCCGCGCCAGCATG
ACTTCGATCTGTCAGTTGATCCTTGGAATTGCGCTGAAGCGTCTCATGGGACTTAACAAGGAGTGCCGGACCAAG
GAATACACTCAAATGATGCAGCTGCGGCGTTATATTAATTCAATGATCCTTTCGCATGAACTATTGCACGATGCC
TTCTCTATCCTTGGCGCTCACTACGAAGTCGTTTCCGTTGTATACCGTGCGATGGGAGCGAAAATCGGCAAGCGC
ATATACTGGCCAGGGTCTGGAGTTGTTTGCCAGGATCCCGAACTTCTTGAAATTGGAGACGATGTAGTGTTTGGG
TCACGTTCAGAGATCCTCACAAATGATCGGCTAGGGACAAAAAAGGTCGTCATTGGCAGTGGAGCGATGATTGCA
GATCGTGTGGTTCTTCTCCCGGGATGCAATGTAGGTAGACGGACAGTGATGGGTTCAGGTGCCCTTGGAAAGAGA
GACACTCTGTACGAGGACGGTTCGACTTGGATGGGATGTGAAAACGGCGAAGCCATCTGTTTCGGACGGAGCGAC
AGGGATTATCCCGAGAAGGAAGTCACAAGTACGAGCACACCTTTCGGTCGGGCTTTCTACGAGGGGAAAGCCGAC
TATTGGGTATTCCCCTACTGGTTTATTCTGGGATCAAATTTGGCAATGACTGCCATCTCTGCCGCATACTGGTCA
ATAAGCCCTGTCGCCGCTGCGCTGCTTCTGCGACACATCCACTTACAGTTTAACCACACTAGCCTCTTCAAGCCG
AGCTGGTATCGACTCGGGGTTTTATATATTCTCATCGCTATATGCTTCATTGTTGTGCTCAACTTGCAGGCTACT
ATTGCTATCCTCTGGGCAGTTGCAACGAAGTGGCTTGTCATTGGTGAGCGTCGTCAAGGTCGGTACGAATGGGAT
AAGAGCGACTATTGTCAGCGGTGGCAACTGCATCTTTCATTGTGTCGTCTTCTCTACCGGGGTTACGGTGTGGGT
GGTATCCTCGGCAATCTCAACGGCTCCGCATATATTGTTTGGTTTTATCGTTCCCTTGGTGCGACCATCGGAAAG
AACTGTGCTCTTTTCGCCGGAGGTATCAGCGGTCTAATGACGGAACCCGATCTTGTCGAGATTGGAGACGACGTG
AGCTTGGACGATTGCTCAGTTGTAGCGCATATCAACTCAAGGGGAGTGTTCGCGTTGAATCACCTGAAAATCGGC
AATGGCTGTGCTCTCCGTTCGGGCTCGCGGCTTCTTTCAGGCGCCTCAATGGAGGACAAGAGCATGCTTTGTGAA
CATACGCTTCTTGTCTCCGGTGATATTGCCGAGTCCGGTTACGCCTATTCTGGCTGGCCCGCCCAGAGGCAATCG
CCTGAAGCCGAAGTGACAGAACCTCCAGCCTCGCCAGGAGGTCAACTTATTTGTCCTATCTGTCGCCAGTTCCCA
CAGCACGCCGTGGTGACGAACTGTGGACATCTGTTCTGCATGCGCTGCATTAATCAGACAATAACAAATCAACGT
CGCTGCCCCATCTGTCGCGCTCCGGTGTCCCGTGCTCAACTGCGTCAAATTCGTCCTTCCTTCGTGGCTAGTGAT
CAGGACCACACCCAGCAAGGACATGCTGATGTCACTTAA
Transcript >AgabiH97|090280
ATGTCAGTTCCTCTCTCCTCCCTGCGTGCTCGCGCCCTCCCGAACGACATCGCATTGGGTCGCTGGATAGCTGAC
CAACTAGCAAATTCCTCTCACATCGGCTCGCTTTTAGACTGCCTACCTTCTACCCACAACCCCGCTATATTCTCT
CCAGAGCCCTCACAGCGAGCCCTCACACATGACCAACTACGCACATTCATCTCCACATTTGTATTGCCTCATTCT
CCGACGCATACACCCTTAAGACCCAACGACCGTGTTCTCGTCGCCCTTCCAAATGGCCCACTCAACGCTTTGGCT
CTGCTCTCTGTCGCATCCTATCATACATGTGCTCCCGTCAATGCTTCATGTACGCCCAGCGAGCTTAGGGACGAT
GCCATTAGGCTAGGGGCAAAACTTATACTCGCTTCCATCGACTCCATAGAACGACTCGGCTTAGGGTCATTACAA
GAAGAGCTAGGCTGTGACGTTATTATTGCCAAGCCCCATGCTGACGGCCCGTCTGGAATGTTCACAATGACTTGC
TTGAACAAGCAAACAATATTTCCCCGCAGCCCTTCCCGGCTTCATGAACTGGACGATTTATCCCTTGTTCTCCAG
ACTTCTGGAACCAGCGGAAGAAAGAAAGTAGTCCCGTATTCTCTTCGTACATTGGTTGTGGGGGCTTGGGCCGTT
GTTCAATCATGGTCCTTGAAGGAGGATGACGTTAATTTGAATATGATGCCTCTTTTCCATGTCGGCGGGTTTGTA
CGGAGCTTGTGCGCTCCTATTCTTTCTGGGGGCGGTACTATCATGTGCAGTGGGTTTGATGCTGTTGCTTTTTGG
GATGTCGCTATTCGCTTCGGGGCTACTTGGTACTATGGGGCGCCAACTGTACACCACGCTATCTTATCTTCCCGC
CCACCTCATGTCAATGCTATGAAAGACTCACGTATGCGCATGATCTGTAACGCAGCAGGAGGATTGTTACCCTCT
CTTGCGACGGAAATGAAAGAAACTTTTGGGAAAGCCGTAATCCTTCCGTCTTATGGCATGACAGAGTGCATGCCA
ATCGCTTCTCCGCCCCAAGACTATCAGTTAGAACGTCCGGGTTGCTCGGGTATTGCCTGTGGTCCGGAAGTATCT
ATTCGCGACCCGTTTAATATTGACCGTGAATTGCCTCGGGGTAGTACTGGCGCGATCGCTGTCCGCGGTTTTCCA
ATGTTTTCTGGCTATGAAACATCTCCCGATAGAAGCGTGCCTCTAGATACTTCTTGCTTTTCGTCTGAAGGCTGG
TTTGACACAGGAGACATGGGCTATTTTGATTCCGACGGATATCTATACATAACCGGTCGATCAAAGGAGATAATC
AACAAGGGTGGCGAGGTTATATCTCCGTTCGAGATTGAAGAGGCGATTATCACAGCGGCTAAGGATCGTGTCAAG
AGCACACTTGCGTTCACCGTTGAGCACGATGTTCTACAAGAAGCAATAGGGGTTGTAATCGTCTGCGTGTCTAAC
AAGCCACGAATTGGCCTTCATCAGCTGCAAGACAGTCTACGCGATCACCTTCACCCGTCTAAGTGGCCCTCCGTG
GTTGTTTATATGGATGACCTTCCTAAAAACAGCACTGGAAAGGCAGTTCGCATCAACTTAGCAAAGCGTCTTGGT
CTCCCTTCTTTCCATGATGGCATTCCAGTGAACCGACGCCATTTCGACGCGCAGGTCCCCTCACCCCGTGCATCC
TTATCAGAATCGATCCCTTGTTCCCGCGTATCGTTGACTTCAAAAGGAGTGGAATCACTTCTGGGACGTATGAAA
GAAGTCAATGATCTTGCTCTGAATTTATCTCCCGATGGGGCTGCTGAATTATATTTAAGCGTCGATTCCAGGTGT
CTCTTGAACTCAGAGGCATTCAAGGCTATCATTTCCCAGGAAGTTGATGGATACTTGGTACCCGAAGTGGTTTAC
TTGATGCATGGCTCTTTGTCGCGAGACATGAGTGGCGAGGTAGACTTCCTAGAAGCTAGAAGGACGTCTGCACAG
TTTGCTTCCGCTTCAATGTCAAAAACCGAGTCTCGCATCAGAGATCTCGTGGCCGAGATCCTATCGGTGGATCGT
GCTAGTATCACTCCTCGATCAGACTTTTTCCTCATCGGGGGCAATTCACTTCTTCTTGGGAAGCTCGCTTACCAT
ATTCGTAAAGAAACTGGAATACCAATTGGTGTTTCGTCTCTGTTCAACAACTGTACGATTGGCGAGATGGCAGCT
CTCGTAGATGCAGAAGGGCCAAAAGGATCATTTTTCTCGGTAGATGAGAAGGAACGAGATCCTCATTCCGATACG
ACGTCAACAGCAACTTTTGGGCTCGAGTATGATTATGATCAGGAATATCAAGTATTCGAAAAGGCAAAGGCGCGC
GGTCAGACCCATCCTCTTTGTTTAATCACTCAGGCAATCCCAGTTTTATTCTTCTATCCGCTGAAGGCCGCACTT
ACTTGGTCCCTCCTACTTTTCACGTTATCTTATATCGCGCAATTTCTTGATGGGGGTTTTTGGGTGAAACTCGGC
ACCCTAATAGCCGCTATCATTGCTTCGAGAATGGCTGTCAGGATTATCGCTCCAATCATTGCTATATTGTTCAAA
TGGCTGGTGGTGGGCAAGTATCAGGCGGGAACATATCGCATGTGGTCTGTCTACTATCTTCGGTGTTGGTTAGTA
GATCAAAGTATAAGATCCTCTGGCAAAGGACTTTTCGCTCTTCACCCTTCTTTGACGATCTTATATTATCGACTA
CTCGGTGCCAAGATAGGCAAGAACGTGTTCATCGATCCTAAAACTAAGCTAGGAGAATATGATATGTTAACATTT
CAGGATGGATGCCGCGTTGATAAGTCCCATATAAGGGGATTCTGTGTGGAAAGAGAGGGACATTTCCGACTGGAT
CCTATCAACATCGGGAAACGTGCTGTCATCAACACCTATACTTCAATCTCTCCCGGAGCTATCATCCCCGACAGT
GCCGTTTACGGTCCCCACGCATCTTCTCATGATGCACCGTTTCCCAAATCATACGCTATATACAATCGTACACTG
AGCTCGGGACCTCATTGGCTTCTTCAAGTTTTAGTTGCTTGGCCACTCATTATCTTAGTCGTGGCAATAGCTCAT
ATCCCATGGATATTTTGCCTGTGGCTCATGATCCAGGAAGTTCAATTCGATACGATCGGCTTGAATGCTCTTGAG
GCAGTCATCTGGTGGTTCGCTGATCCGCGTCGAGTTGCATACCATACGTTATCCCGAGTTGTCCGCGCCAGCATG
ACTTCGATCTGTCAGTTGATCCTTGGAATTGCGCTGAAGCGTCTCATGGGACTTAACAAGGAGTGCCGGACCAAG
GAATACACTCAAATGATGCAGCTGCGGCGTTATATTAATTCAATGATCCTTTCGCATGAACTATTGCACGATGCC
TTCTCTATCCTTGGCGCTCACTACGAAGTCGTTTCCGTTGTATACCGTGCGATGGGAGCGAAAATCGGCAAGCGC
ATATACTGGCCAGGGTCTGGAGTTGTTTGCCAGGATCCCGAACTTCTTGAAATTGGAGACGATGTAGTGTTTGGG
TCACGTTCAGAGATCCTCACAAATGATCGGCTAGGGACAAAAAAGGTCGTCATTGGCAGTGGAGCGATGATTGCA
GATCGTGTGGTTCTTCTCCCGGGATGCAATGTAGGTAGACGGACAGTGATGGGTTCAGGTGCCCTTGGAAAGAGA
GACACTCTGTACGAGGACGGTTCGACTTGGATGGGATGTGAAAACGGCGAAGCCATCTGTTTCGGACGGAGCGAC
AGGGATTATCCCGAGAAGGAAGTCACAAGTACGAGCACACCTTTCGGTCGGGCTTTCTACGAGGGGAAAGCCGAC
TATTGGGTATTCCCCTACTGGTTTATTCTGGGATCAAATTTGGCAATGACTGCCATCTCTGCCGCATACTGGTCA
ATAAGCCCTGTCGCCGCTGCGCTGCTTCTGCGACACATCCACTTACAGTTTAACCACACTAGCCTCTTCAAGCCG
AGCTGGTATCGACTCGGGGTTTTATATATTCTCATCGCTATATGCTTCATTGTTGTGCTCAACTTGCAGGCTACT
ATTGCTATCCTCTGGGCAGTTGCAACGAAGTGGCTTGTCATTGGTGAGCGTCGTCAAGGTCGGTACGAATGGGAT
AAGAGCGACTATTGTCAGCGGTGGCAACTGCATCTTTCATTGTGTCGTCTTCTCTACCGGGGTTACGGTGTGGGT
GGTATCCTCGGCAATCTCAACGGCTCCGCATATATTGTTTGGTTTTATCGTTCCCTTGGTGCGACCATCGGAAAG
AACTGTGCTCTTTTCGCCGGAGGTATCAGCGGTCTAATGACGGAACCCGATCTTGTCGAGATTGGAGACGACGTG
AGCTTGGACGATTGCTCAGTTGTAGCGCATATCAACTCAAGGGGAGTGTTCGCGTTGAATCACCTGAAAATCGGC
AATGGCTGTGCTCTCCGTTCGGGCTCGCGGCTTCTTTCAGGCGCCTCAATGGAGGACAAGAGCATGCTTTGTGAA
CATACGCTTCTTGTCTCCGGTGATATTGCCGAGTCCGGTTACGCCTATTCTGGCTGGCCCGCCCAGAGGCAATCG
CCTGAAGCCGAAGTGACAGAACCTCCAGCCTCGCCAGGAGGTCAACTTATTTGTCCTATCTGTCGCCAGTTCCCA
CAGCACGCCGTGGTGACGAACTGTGGACATCTGTTCTGCATGCGCTGCATTAATCAGACAATAACAAATCAACGT
CGCTGCCCCATCTGTCGCGCTCCGGTGTCCCGTGCTCAACTGCGTCAAATTCGTCCTTCCTTCGTGGCTAGTGAT
CAGGACCACACCCAGCAAGGACATGCTGATGTCACTTAA
Gene >AgabiH97|090280
ATGTCAGTTCCTCTCTCCTCCCTGCGTGCTCGCGCCCTCCCGAACGACATCGCATTGGGTCGCTGGATAGCTGAC
CAACTAGCAAATTCCTCTCACATCGGCTCGCTTTTAGACTGCCTACCTTCTACCCACAACCCCGCTATATTCTCT
CCAGAGCCCTCACAGCGAGCCCTCACACATGACCAACTACGCACATTCATCTCCACATTTGTATTGCCTCATTCT
CCGACGCATACACCCTTAAGACCCAACGACCGTGTTCTCGTCGCCCTTCCAAATGGCCCACTCAACGCTTTGGCT
CTGCTCTCTGTCGCATCCTATCATACATGTGCTCCCGTCAATGCTTCATGTACGCCCAGCGAGCTTAGGGACGAT
GCCATTAGGCTAGGGGCAAAACTTATACTCGCTTCCATCGACTCCATAGAACGACTCGGCTTAGGGTCATTACAA
GAAGAGCTAGGCTGTGACGTTATTATTGCCAAGCCCCATGCTGACGGCCCGTCTGGAATGTTCACAATGACTTGC
TTGAACAAGCAAACAATATTTCCCCGCAGCCCTTCCCGGCTTCATGAACTGGACGATTTATCCCTTGTTCTCCAG
ACTTCTGGAACCAGCGGAAGAAAGAAAGTAGTCCCGTATTCTCTTCGTACATTGGTTGTGGGGGCTTGGGCCGTT
GTTCAATCATGGTCCTTGAAGGAGGATGACGTTAATTGTGAGCCTTGATAAACACCATCGAAATTCGTGCTGAAC
TCCTCGGTAGTGAATATGATGCCTCTTTTCCATGTCGGCGGGTTTGTACGGAGCTTGTGCGCTCCTATTCTTTCT
GGGGGCGGTACTATCATGTGCAGTGGGTTTGATGCTGTTGCTTTTTGGGATGTCGCTATTCGCTTCGGGGCTACT
TGGTAAAATTGAAAAATTCCTATTTCCTATGAAAGATCAAATACTAAACATCCATTCAGGTACTATGGGGCGCCA
ACTGTACACCACGCTATCTTATCTTCCCGCCCACCTCATGTCAATGCTATGAAAGACTCACGTATGCGCATGATC
TGTAACGCAGCAGGAGGATTGTTACCCTCTCTTGCGACGGAAATGAAAGAAACTTTTGGGAAAGCCGTAATCCTT
CCGTCTTATGGCATGACAGAGTACGTTATTCATGAAATATTTTTGTCTCTCCGAAATGGACTTAGAGCGCTGGAA
ACTGTAGGTGCATGCCAATCGCTTCTCCGCCCCAAGACTATCAGTTAGAACGTCCGGGTTGCTCGGGTATTGCCT
GTGGTCCGGAAGTATCTATTCGCGACCCGTTTAATATTGACCGTGAATTGCCTCGGGGTAGTACTGGCGCGATCG
CTGTCCGCGGTTTTCCAATGTTTTCTGGCTATGAAACATCTCCCGATAGAAGCGTGCCTCTAGATACTTCTTGCT
TTTCGTCTGAAGGCTGGTTTGACACAGGAGACATGGGCTATTTTGATTCCGACGGGTAGGTGCTAAATTTAGAAC
AAGAGACGCTCATCTCCAGTTGGCAACAGATATCTATACATAACCGGTCGATCAAAGGAGATAATCAACAAGGGT
GGCGAGGTTATATCTCCGTTCGAGATTGAAGAGGCGATTATCACAGCGGCTAAGGATCGTGTCAAGGTCCGTTGA
TTCCGACCTATAGCGCTCATTTATGTGAATTGCCCTGTTTAGAGCACACTTGCGTTCACCGTTGAGCACGATGTT
CTACAAGAAGCAATAGGGGTTGTAATCGTCTGCGTGTCTAACAAGCCACGAATTGGCCTTCATCAGCTGCAAGAC
AGTCTACGGTAAGAATTGGATGTCTGCTCTAAAATTACGAATTGAACATGTCCGCAGCGATCACCTTCACCCGTC
TAAGTGGCCCTCCGTGGTTGTTTATATGGATGACCTTCCTAAAAACAGGTGAGTTTTCGACCTTTCCAAAATACT
CAATAACCGCTGAACCAGCCTATCAGCACTGGAAAGGCAGTTCGCATCAACTTAGCAAAGCGTCTTGGTCTCCCT
TCTTTCCATGATGGCATTCCAGTGAACCGACGCCATTTCGACGCGCAGGTCCCCTCACCCCGTGCATCCTTATCA
GAATCGATCCCTTGTTCCCGCGTATCGTTGACTTCAAAAGGAGTGGAATCACTTCTGGGACGTATGAAAGAAGTC
AATGATCTTGCTCTGAATTTATCTCCCGATGGGGCTGCTGAATTATATTTAAGCGTCGATTCCAGGTGTCTCTTG
AACTCAGAGGCATTCAAGGCTATCATTTCCCAGGAAGTTGATGGATACTTGGTACCCGAAGTGGTTTACTTGATG
CATGGCTCTTTGTCGCGAGACATGAGTGGCGAGGTAGACTTCCTAGAAGCTAGAAGGACGTCTGCACAGTTTGCT
TCCGCTTCAATGTCAAAAACCGAGTCTCGCATCAGAGATCTCGTGGCCGAGATCCTATCGGTGGATCGTGCTAGT
ATCACTCCTCGATCAGACTTTTTCCTCATCGGGGGCAATTCACTTCTTCTTGGGAAGCTCGCTTACCATATTCGT
AAAGAAACTGGAATACCAATTGGTGTTTCGTCTCTGTTCAACAACTGTACGATTGGCGAGATGGCAGCTCTCGTA
GATGCAGAAGGGCCAAAAGGATCATTTTTCTCGGTAGATGAGAAGGAACGAGATCCTCATTCCGATACGACGTCA
ACAGCAACTTTTGGGCTCGAGTATGATTATGATCAGGAATATCAAGTATTCGAAAAGGCAAAGGCGCGCGGTCAG
ACCCATCCTCTTTGTTTAATCACTCAGGCAATCCCAGTTTTATTCTTCTATCCGCTGAAGGCCGCACTTACTTGT
AAGTGAATCAACCAGATCAATTTCCGATTGCGCCTCAGACTTGGTTCACAGGGTCCCTCCTACTTTTCACGTTAT
CTTATATCGCGCAATTTCTTGATGGGGGTTTTTGGGTGAAACTCGGCACCCTAATAGCCGCTATCATTGCTTCGA
GAATGGCTGTCAGGATTATCGCTCCAATCATTGCTATATTGTTCAAATGGCTGGTGGTGGGCAAGTATCAGGCGG
GAACATATCGCATGTAAGTCGCTTATTCTCGGTCTATATTGTGTATTTATCGTTCTTGAAGGTGGTCTGTCTACT
ATCTTCGGTGTTGGTTAGTAGATCAAAGTATAAGGTTCGTCTCCAGGTCCTCCGGCAATTTCTTTCATCGCTCAC
AACGCCGATAGATCCTCTGGCAAAGGACTTTTCGCTCTTCACCCTTCTTTGACGATCTTATATTATCGACTACTC
GGTGCCAAGATAGGCAAGAACGTGTTCATCGATCCTAAAACTAAGCTAGGAGAATATGATATGTTAACATTTCAG
GATGGATGCCGCGTTGATAAGTCCCATATAAGGGGATTCTGTGTGGAAAGAGAGGGACATTTCCGACTGGATCCT
ATCAACATCGGGAAACGTGCTGTCATCAACACCTATACTTCAATCTCTCCCGGAGCTATCATCCCCGACAGTGCC
GTTTACGGTCCCCACGCATCTTCTCATGATGCACCGTTTCCCAAATCATACGCTATATACAATCGTACACTGAGC
TCGGGACCTCATTGGCTTCTTCAAGTTTTAGTTGCTTGGCCACTCATTATCTTAGTCGTGGCAATAGCTCGTAAG
CCATATCTACTATACAAAGTGGTGACAGAAATAACCATTCGTAGATATCCCATGGATATTTTGCCTGTGGCTCAT
GATCCAGGAAGTTCAATTCGATACGATCGGCTTGAATGCTCTTGAGGCAGTCATCTGGTGGTTCGCTGATCCGCG
TCGAGTTGCATACCATACGTTATCCCGAGTTGTCCGCGCCAGCATGACTTCGATCTGTCAGTTGATCCTTGGAAT
TGCGCTGAAGCGTCTCATGGGACTTAACAAGGAGTGCCGGACCAAGGAATACACTCAAATGATGCAGCTGCGGCG
TTATATTAATTCAATGATCCTTTCGCATGAACTATTGCACGATGCCTTCTCTATCCTTGGCGCTCACTACGAAGT
CGTTTCCGTAAGTTTCTATGTGTTAATATTCCAGGAATGGCAGCTAACTCCGTCAACAAGGTTGTATACCGTGCG
ATGGGAGCGAAAATCGGCAAGCGCATATACTGGCCAGGGTCTGGAGTTGTTTGCCAGGATCCCGAACTTCTTGAA
ATTGGAGACGATGTAGTGTTTGGGTCACGTTCAGAGATCCTCACAAATGATCGGCTAGGGACAAAAAAGGTCGTC
ATTGGCAGTGGAGGTAAGGGTTAACCAATTCCGTCGACTTCTCGACCTGACTCGCTTTAGCGATGATTGCAGATC
GTGTGGTTCTTCTCCCGGGATGCAATGTAGGTAGACGGACAGTGATGGGTTCAGGTGCCCTTGGAAAGAGAGACA
CTCTGTACGAGGACGGTTCGACTTGGATGGGATGTGGTGAGAGCCCTTTCACGCATAGTTGAGACTGTCGTACTG
ACAGCTTTGTGAGAAAACGGCGAAGCCATCTGTTTCGGACGGAGCGACAGGGATTATCCCGAGAAGGAAGTCACA
AGTACGAGCACACCTTTCGGTCGGGCTTTCTACGAGGGGAAAGCCGACTATTGGGTATTCCCCTACTGGTTTATT
CTGGGATCAAATTTGGCAATGACTGCCATCTCTGCCGCATACTGGTCAATAAGCCCTGTCGCCGCTGCGCTGCTT
CTGCGACACATCCACTTACAGTTTAACCACACTAGCCTCTTCAAGCCGAGCTGGTATCGACTCGGGGTTTTATAT
ATTCTCATCGCTATATGCTTCATTGTTGTGCTCAACTTGCAGGCTACTATTGCTATCCTCTGGGCAGTTGCAACG
AAGTGGCTTGTCATTGGTGAGCGTCGTCAAGGTCGGTACGAATGGGATAAGAGCGACTATTGTCAGCGGTGGCAA
CTGCATCTTTCATTGTGTCGTCTTCTCTACCGGGGTTACGGTGTGGGTGGTATCCTCGGCAATCTCAACGGCTCC
GCATATATTGTTTGGTTTTATCGTTCCCTTGGTGCGACCATCGGAAAGAACTGTGCTCTTTTCGCCGGAGGTATC
AGCGGTCTAATGACGGAACCCGATCTTGTCGAGGTAAGTTGTGTTTCAATGAATTAACCTGTTCAGGACCATAAT
CGCGCTATCAATTAGATTGGAGACGACGTGAGCTTGGACGATTGCTCAGTTGTAGCGCATATCAACTCAAGGGGA
GTGTTCGCGTTGAATCACCTGAAAATCGGCAATGGCTGTGCTCTCCGTTCGGGCTCGCGGCTTCTTTCAGGCGCC
TCAATGGAGGACAAGAGCATGCTTTGTGAACATACGCTTCTTGTCTCCGGTGATATTGCCGAGTCCGGTTACGCC
TATTCTGGCTGGCCCGCCCAGAGGCAATCGCCTGAAGCCGAAGTGACAGAACCTCCAGCCTCGCCAGGAGGTCAA
CTTATTTGTCCTATCTGTCGCCAGTTCCCACAGCACGCCGTGGTGACGAACTGTGGACATCTGTTCTGCATGCGG
TGAGAGGATTCTTGCATTCAATTGACAACGATTGACTCAACGATCGTACTATAGCTGCATTAATCAGACAATAAC
AAATCAACGTCGCTGCCCCATCTGTCGCGCTCCGGTGTCCCGTGCTCAACTGCGTCAAATTCGTCCTTCCTTCGT
GGCTAGTGATCAGGACCACACCCAGCAAGGACATGCTGATGTCACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail