Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090060
Gene name
Locationscaffold_6:450361..451604
Strand-
Gene length (bp)1243
Transcript length (bp)1104
Coding sequence length (bp)1104
Protein length (aa) 368

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF09445 Methyltransf_15 RNA cap guanine-N2 methyltransferase 1.0E-35 148 357
PF13649 Methyltransf_25 Methyltransferase domain 2.7E-07 150 204
PF02475 Met_10 Met-10+ like-protein 4.7E-07 136 209
PF08241 Methyltransf_11 Methyltransferase domain 2.1E-04 151 204

Swissprot hits

Swissprot ID Swissprot Description Start End E-value
sp|Q96RS0|TGS1_HUMAN Trimethylguanosine synthase OS=Homo sapiens GN=TGS1 PE=1 SV=3 96 359 9.0E-56
sp|Q923W1|TGS1_MOUSE Trimethylguanosine synthase OS=Mus musculus GN=Tgs1 PE=1 SV=2 96 359 2.0E-55
sp|P85107|TGS1_RAT Trimethylguanosine synthase OS=Rattus norvegicus GN=Tgs1 PE=1 SV=1 96 359 6.0E-54
sp|Q09814|TGS1_SCHPO Trimethylguanosine synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=tgs1 PE=1 SV=3 98 317 1.0E-33
sp|Q12052|TGS1_YEAST Trimethylguanosine synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=TGS1 PE=1 SV=1 102 317 3.0E-20

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0009452 7-methylguanosine RNA capping Yes
GO:0001510 RNA methylation Yes
GO:0009451 RNA modification No
GO:0016070 RNA metabolic process No
GO:0006396 RNA processing No
GO:1901360 organic cyclic compound metabolic process No
GO:0071704 organic substance metabolic process No
GO:0008150 biological_process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0008152 metabolic process No
GO:0043412 macromolecule modification No
GO:0046483 heterocycle metabolic process No
GO:0090304 nucleic acid metabolic process No
GO:0043170 macromolecule metabolic process No
GO:0032259 methylation No
GO:0043414 macromolecule methylation No
GO:0006807 nitrogen compound metabolic process No
GO:0016740 transferase activity No
GO:0036260 RNA capping No
GO:0003674 molecular_function No
GO:0044238 primary metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0009987 cellular process No
GO:0003824 catalytic activity No
GO:0044237 cellular metabolic process No
GO:0044260 cellular macromolecule metabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0016741 transferase activity, transferring one-carbon groups No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090060
MGKRKSRTGMTGLSRFISALNEGESGTQPSISTNSVDPAVSAHEQNDLTMKEVNGETNTDSASAPIFTSVATISK
KQKIIPHYDATGLVPTYTNEAMVPDHLKKYFSQRTRYFSLYDTPPGCLLDEEGWYSVTPERVANQIAERCRCDVV
LDAFCGVGGNTIAFAKTCERVIALDTNPTRLALARHNAQIYGVADRIEFIQADYISFARAYLSSFSTPSPSSNTS
TPPRTKTRKIDVVFLSPPWGGPSYLSGSPSHDIVNNVAKDNLPQTDGQDSHPTYSFSSIQPIHGKDLFTLTRRIT
SNIAYYLPRNTDLPEISDLLNATDDHGRSVKLSGERIEVEEEWMGSKLKALTCYFGGLVAGQEDLFS*
Coding >AgabiH97|090060
ATGGGCAAACGTAAATCAAGGACTGGGATGACTGGGCTGTCGCGTTTTATCAGTGCTTTGAATGAAGGAGAGTCC
GGGACACAACCCTCGATCTCAACGAACTCTGTCGACCCAGCTGTCTCGGCTCACGAGCAGAACGATCTTACAATG
AAAGAAGTTAATGGCGAAACAAACACAGACTCTGCGTCAGCGCCAATCTTTACTTCTGTCGCAACAATATCGAAG
AAACAAAAAATCATTCCTCACTATGACGCGACCGGTCTCGTACCCACATATACCAACGAAGCTATGGTCCCAGAT
CATCTCAAGAAATACTTCTCTCAGCGAACACGATATTTTTCGTTATACGATACGCCGCCTGGATGCCTTCTCGAT
GAAGAAGGATGGTACAGCGTGACACCTGAGAGGGTTGCAAATCAAATAGCTGAGCGATGTCGATGCGACGTCGTT
TTAGATGCTTTCTGCGGTGTCGGTGGGAATACTATCGCTTTTGCCAAAACTTGCGAACGAGTGATTGCGCTGGAT
ACCAATCCCACGAGGTTAGCGCTGGCGAGGCACAACGCTCAGATATACGGCGTTGCAGATCGTATAGAATTTATC
CAAGCAGATTATATTTCATTTGCCCGCGCATATCTTTCCTCGTTCTCGACCCCGTCGCCGTCATCAAATACCTCG
ACGCCGCCACGAACTAAAACAAGAAAGATTGACGTCGTGTTTCTCAGTCCTCCGTGGGGTGGCCCTTCCTACCTC
TCAGGTTCACCCAGCCATGACATCGTCAACAACGTTGCCAAGGATAATCTCCCTCAGACTGATGGTCAAGATTCA
CACCCCACTTATTCCTTTTCATCTATTCAGCCTATTCACGGGAAAGATCTTTTTACTCTCACACGCAGAATCACA
TCAAACATTGCATATTATTTACCTCGCAACACTGATCTTCCAGAAATCAGTGATTTGTTAAATGCTACCGATGAT
CATGGCCGTTCGGTAAAGTTATCGGGAGAGCGGATTGAGGTTGAAGAGGAGTGGATGGGGAGTAAGCTGAAAGCT
TTGACGTGTTATTTTGGTGGGCTTGTCGCCGGACAGGAAGATTTGTTCTCTTAG
Transcript >AgabiH97|090060
ATGGGCAAACGTAAATCAAGGACTGGGATGACTGGGCTGTCGCGTTTTATCAGTGCTTTGAATGAAGGAGAGTCC
GGGACACAACCCTCGATCTCAACGAACTCTGTCGACCCAGCTGTCTCGGCTCACGAGCAGAACGATCTTACAATG
AAAGAAGTTAATGGCGAAACAAACACAGACTCTGCGTCAGCGCCAATCTTTACTTCTGTCGCAACAATATCGAAG
AAACAAAAAATCATTCCTCACTATGACGCGACCGGTCTCGTACCCACATATACCAACGAAGCTATGGTCCCAGAT
CATCTCAAGAAATACTTCTCTCAGCGAACACGATATTTTTCGTTATACGATACGCCGCCTGGATGCCTTCTCGAT
GAAGAAGGATGGTACAGCGTGACACCTGAGAGGGTTGCAAATCAAATAGCTGAGCGATGTCGATGCGACGTCGTT
TTAGATGCTTTCTGCGGTGTCGGTGGGAATACTATCGCTTTTGCCAAAACTTGCGAACGAGTGATTGCGCTGGAT
ACCAATCCCACGAGGTTAGCGCTGGCGAGGCACAACGCTCAGATATACGGCGTTGCAGATCGTATAGAATTTATC
CAAGCAGATTATATTTCATTTGCCCGCGCATATCTTTCCTCGTTCTCGACCCCGTCGCCGTCATCAAATACCTCG
ACGCCGCCACGAACTAAAACAAGAAAGATTGACGTCGTGTTTCTCAGTCCTCCGTGGGGTGGCCCTTCCTACCTC
TCAGGTTCACCCAGCCATGACATCGTCAACAACGTTGCCAAGGATAATCTCCCTCAGACTGATGGTCAAGATTCA
CACCCCACTTATTCCTTTTCATCTATTCAGCCTATTCACGGGAAAGATCTTTTTACTCTCACACGCAGAATCACA
TCAAACATTGCATATTATTTACCTCGCAACACTGATCTTCCAGAAATCAGTGATTTGTTAAATGCTACCGATGAT
CATGGCCGTTCGGTAAAGTTATCGGGAGAGCGGATTGAGGTTGAAGAGGAGTGGATGGGGAGTAAGCTGAAAGCT
TTGACGTGTTATTTTGGTGGGCTTGTCGCCGGACAGGAAGATTTGTTCTCTTAG
Gene >AgabiH97|090060
ATGGGCAAACGTAAATCAAGGACTGGGATGACTGGGCTGTCGCGTTTTATCAGTGCTTTGAATGAAGGAGAGTCC
GGGACACAACCCTCGATCTCAACGAACTCTGTCGACCCAGCTGTCTCGGCTCACGAGCAGAACGATCTTACAATG
AAAGAAGTTAATGGCGAAACAAACACAGACTCTGCGTCAGCGCCAATCTTTACTTCTGTCGCAACAATATCGAAG
AAACAAAAAATCATTCCTCACTATGACGCGACCGGTCTCGTACCCACATATACCAACGAAGCTATGGTCCCAGAT
CATCTCAAGAAATGTCCGTGCTTGTCATAGGGTTCTTAACGTCGCTTAAAACGACAAACTCATGCCACTTGTATT
GGTTGCCTCCGCTTGTAGACTTCTCTCAGCGAACACGATATTTTTCGTTATACGATACGCCGCCTGGATGCCTTC
TCGATGAAGAAGGATGGTACAGCGTGACACCTGAGAGGGTTGCAAATCAAATAGCTGAGCGATGTCGATGCGACG
TCGTTTTAGATGCTTTCTGCGGTGTCGGTGGGAATACTATCGCTTTTGCCAAAACTTGCGAACGAGGTTTGGAGG
ACAAATTTATCTTTTTTTTTTACCTTCAGCTGAGGCTCGCCCTTTTCTAGTGATTGCGCTGGATACCAATCCCAC
GAGGTTAGCGCTGGCGAGGCACAACGCTCAGATATACGGCGTTGCAGATCGTATAGAATTTATCCAAGCAGATTA
TATTTCATTTGCCCGCGCATATCTTTCCTCGTTCTCGACCCCGTCGCCGTCATCAAATACCTCGACGCCGCCACG
AACTAAAACAAGAAAGATTGACGTCGTGTTTCTCAGTCCTCCGTGGGGTGGCCCTTCCTACCTCTCAGGTTCACC
CAGCCATGACATCGTCAACAACGTTGCCAAGGATAATCTCCCTCAGACTGATGGTCAAGATTCACACCCCACTTA
TTCCTTTTCATCTATTCAGCCTATTCACGGGAAAGATCTTTTTACTCTCACACGCAGAATCACATCAAACATTGC
ATATTATTTACCTCGCAACACTGATCTTCCAGAAATCAGTGATTTGTTAAATGCTACCGATGATCATGGCCGTTC
GGTAAAGTTATCGGGAGAGCGGATTGAGGTTGAAGAGGAGTGGATGGGGAGTAAGCTGAAAGCTTTGACGTGTTA
TTTTGGTGGGCTTGTCGCCGGACAGGAAGATTTGTTCTCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail