Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|090010
Gene name
Locationscaffold_6:435848..440859
Strand-
Gene length (bp)5011
Transcript length (bp)4314
Coding sequence length (bp)4314
Protein length (aa) 1438

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00651 BTB BTB/POZ domain 6.3E-05 826 946
PF12796 Ank_2 Ankyrin repeats (3 copies) 3.2E-07 49 125
PF13540 RCC1_2 Regulator of chromosome condensation (RCC1) repeat 1.8E-07 257 286
PF13637 Ank_4 Ankyrin repeats (many copies) 3.5E-07 58 114

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 51 572 2.0E-68
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 51 376 3.0E-35
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 54 366 8.0E-34
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 54 383 2.0E-26
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 153 447 3.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 51 572 2.0E-68
sp|Q6NRS1|IBTK_XENLA Inhibitor of Bruton tyrosine kinase OS=Xenopus laevis GN=ibtk PE=2 SV=1 51 376 3.0E-35
sp|Q9P2D0|IBTK_HUMAN Inhibitor of Bruton tyrosine kinase OS=Homo sapiens GN=IBTK PE=1 SV=3 54 366 8.0E-34
sp|Q6ZPR6|IBTK_MOUSE Inhibitor of Bruton tyrosine kinase OS=Mus musculus GN=Ibtk PE=1 SV=3 54 383 2.0E-26
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 153 447 3.0E-14
sp|Q5RCZ7|RCBT2_PONAB RCC1 and BTB domain-containing protein 2 OS=Pongo abelii GN=RCBTB2 PE=2 SV=1 154 455 2.0E-13
sp|O95199|RCBT2_HUMAN RCC1 and BTB domain-containing protein 2 OS=Homo sapiens GN=RCBTB2 PE=1 SV=1 154 455 2.0E-13
sp|Q99LJ7|RCBT2_MOUSE RCC1 and BTB domain-containing protein 2 OS=Mus musculus GN=Rcbtb2 PE=2 SV=1 154 454 5.0E-13
sp|Q6P798|RCBT2_RAT RCC1 and BTB domain-containing protein 2 OS=Rattus norvegicus GN=Rcbtb2 PE=2 SV=1 154 366 1.0E-12
sp|Q3MHW0|SRGEF_BOVIN Secretion-regulating guanine nucleotide exchange factor OS=Bos taurus GN=SERGEF PE=2 SV=1 145 343 2.0E-11
sp|Q80YD6|SRGEF_MOUSE Secretion-regulating guanine nucleotide exchange factor OS=Mus musculus GN=Sergef PE=2 SV=2 147 343 8.0E-11
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 121 447 2.0E-10
sp|O74881|BTB1_SCHPO BTB/POZ domain-containing protein 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=btb1 PE=1 SV=1 759 988 3.0E-10
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 153 366 3.0E-10
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 149 366 3.0E-10
sp|Q8IVU3|HERC6_HUMAN Probable E3 ubiquitin-protein ligase HERC6 OS=Homo sapiens GN=HERC6 PE=2 SV=2 208 484 5.0E-10
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 153 348 8.0E-10
sp|Q8NDN9|RCBT1_HUMAN RCC1 and BTB domain-containing protein 1 OS=Homo sapiens GN=RCBTB1 PE=2 SV=1 154 374 6.0E-09
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 153 381 2.0E-08
sp|Q9UGK8|SRGEF_HUMAN Secretion-regulating guanine nucleotide exchange factor OS=Homo sapiens GN=SERGEF PE=1 SV=2 161 348 6.0E-08
sp|Q6NXM2|RCBT1_MOUSE RCC1 and BTB domain-containing protein 1 OS=Mus musculus GN=Rcbtb1 PE=2 SV=1 140 366 9.0E-08
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 156 392 3.0E-07
sp|Q5DX34|RPGRH_CAEEL X-linked retinitis pigmentosa GTPase regulator homolog OS=Caenorhabditis elegans GN=glo-4 PE=1 SV=2 206 347 5.0E-07
sp|P28745|RCC1_SCHPO Protein pim1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pim1 PE=1 SV=2 155 453 5.0E-07
sp|Q9FN03|UVR8_ARATH Ultraviolet-B receptor UVR8 OS=Arabidopsis thaliana GN=UVR8 PE=1 SV=1 157 348 7.0E-07
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 149 350 1.0E-06
sp|O95714|HERC2_HUMAN E3 ubiquitin-protein ligase HERC2 OS=Homo sapiens GN=HERC2 PE=1 SV=2 149 350 1.0E-06
sp|Q6PAV2|HERC4_MOUSE Probable E3 ubiquitin-protein ligase HERC4 OS=Mus musculus GN=Herc4 PE=1 SV=2 155 350 1.0E-06
sp|F2Z461|HERC6_MOUSE E3 ISG15--protein ligase Herc6 OS=Mus musculus GN=Herc6 PE=2 SV=1 208 456 2.0E-06
sp|Q5PQN1|HERC4_RAT Probable E3 ubiquitin-protein ligase HERC4 OS=Rattus norvegicus GN=Herc4 PE=2 SV=1 155 350 3.0E-06
sp|Q15751|HERC1_HUMAN Probable E3 ubiquitin-protein ligase HERC1 OS=Homo sapiens GN=HERC1 PE=1 SV=2 153 366 4.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 149 366 7.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 214 447 8.0E-06
sp|Q5GLZ8|HERC4_HUMAN Probable E3 ubiquitin-protein ligase HERC4 OS=Homo sapiens GN=HERC4 PE=1 SV=1 155 350 8.0E-06
sp|P25171|RCC1_DROME Regulator of chromosome condensation OS=Drosophila melanogaster GN=Rcc1 PE=1 SV=2 176 348 8.0E-06
sp|Q9VR91|HERC2_DROME Probable E3 ubiquitin-protein ligase HERC2 OS=Drosophila melanogaster GN=HERC2 PE=1 SV=3 149 348 9.0E-06
sp|Q15034|HERC3_HUMAN Probable E3 ubiquitin-protein ligase HERC3 OS=Homo sapiens GN=HERC3 PE=1 SV=1 214 366 9.0E-06
sp|Q4U2R1|HERC2_MOUSE E3 ubiquitin-protein ligase HERC2 OS=Mus musculus GN=Herc2 PE=1 SV=3 155 348 1.0E-05
[Show less]

GO

GO Term Description Terminal node
GO:0005515 protein binding Yes
GO:0005488 binding No
GO:0003674 molecular_function No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 26 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|090010
MSLLHDAFNARNLHLFQRLVDTSNAADKSASVSSTSVGKVSKHSSLGNIDVNQRDWLGRTVLHLASAAIEHLDYV
RILLKHPAISVNAADTESHWTPLHRSLYSANLPAARLLLQRPDIDIFLKDNEGYTAFDLYNSTLVGTKPSPEEIG
GYADLYTWGTNVNAALGLGDSNDRAYPELAVLPRREDEADLERQSLSARFLPIKAEHVEMSKLHTVVVTSETGGN
LRVCGFGSGGRLGPNSHTQYLLKPLSQLTQAITSIALGQDHTLALTKAGEVLSWGLNRFSQLGYPVDPPTSGRLE
EPIQYSPRRVQGPLRKEVVKGVAASKVASACWTDDGVYTWGTNNGQLGYDKAAQPVQVQPRKVSRLTVSVISIVM
TENVMACLMQNRQVECFYDDGHHRINFPTLAFPSPIRPYRPPQAAKDSRMAKITCCGDVFAALTSHGEVYIFSPS
SSHSANSIPSSSSSANLSTSFNDSEVPTRMGGPFKCQRVWALRKKFSAVKDVALGADGSIIICTESGHVYVRTRN
VKMSSVGGSGSSSSQKAFKFVKVPGLQRVTRVCASASGAFGALRVEYRMKNVEVKGNFVAQDLSRVRPWLESGKD
DASLDTCAMEPDDENEDSGRDKEENAISSFGYGHDSDNEDAEGRGEDDAIVNDIRLLREMCDVIKREDKRKKDGR
RLEHMHLRHGADTLLVLSSSNIAFPVHRAILGVRSKVLCAFYRLYNDILPILSRYADRDPTRISTSIINSYAKGL
KIKMDPGLIKNELQVLGRMLDLSEMLKVLERPIKLDVRPTLARDLSELFDVVNLERDDDDDEGGVEKVAPRALCE
DVILELADREVFTHSVILRSRSNLFKSFFDEPVWTLNRWETEGIDYDEGGHGILRIDLKHLKWRVMEFVLKFMCC
GCDKELFERLEFVDGVDDLVEFMFEVMAAANELLLDRLVLLCSEVILTYTSLHNACYVLYLATYYSATQLIDRVQ
SFITANMELFLQSYMLDDIPLDLLTQLSNYAQEKQKEKAPFVRGGVLEEGVMEKWRKWVEDLDVPIPIVRSNKPW
KEKKGLPLPDFGKDKRGGREKGLRRPPSGDDIFIMDDTDLLSPQLGSSSTPGPAWKVYVAPKVDMKTVMAEAAAS
QIRPSKSKEPLRTPSKSQLVPQSPPQTASNVGSTSSPQRVVRTSSYPGSPPTPSFPSLTPQKQKEGVVRQQQQQQ
NVTPTKQGGSSLGNVLGAAGGSVMGPTITPMRMPAVNLKSGQRSVSGPSKAWAYTRPIDPIPPPVLISPTPTPNE
PSSSTFKTTTKSFLAIQQEEEEQQQQFGDLQRGDKRSLLDIQEEERARRQEEEFLKWWEEEEVRVKMEMEVAQSS
GSGGKSKRGGGRKGGGEKGDRRGGGGGSEGSGRSGPKGRKEGRKVQKNPGDNNATPPSSSSTRPPPRNHRKNTAQ
GQEPILPMSSGS*
Coding >AgabiH97|090010
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCATAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTCTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCAGCCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGAC
AATGAGGGCTACACCGCGTTCGACCTGTACAATTCTACCCTCGTCGGGACAAAGCCGTCTCCGGAAGAAATAGGT
GGTTATGCTGACCTATACACCTGGGGCACGAACGTAAATGCCGCTCTTGGGCTCGGGGATAGTAATGATAGGGCG
TATCCAGAACTAGCTGTCCTTCCTCGCAGAGAAGATGAGGCTGATTTGGAGAGACAAAGCTTATCGGCTCGATTC
TTGCCGATCAAGGCCGAGCATGTAGAGATGTCGAAGTTACACACTGTTGTTGTGACATCGGAAACTGGAGGAAAC
CTGCGTGTTTGTGGGTTTGGCAGTGGCGGAAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAACCTCTT
TCTCAACTCACGCAAGCCATTACCTCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAA
GTTCTCAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAA
GAACCTATACAGTATTCACCCAGGCGGGTTCAAGGTCCCTTGAGGAAGGAAGTTGTCAAAGGTGTCGCAGCTAGC
AAAGTCGCTTCGGCTTGTTGGACGGACGACGGCGTCTATACATGGGGAACGAATAACGGTCAGCTGGGATATGAC
AAAGCTGCCCAACCAGTTCAGGTCCAGCCGCGCAAAGTTTCGCGTTTAACGGTGTCTGTTATCTCGATCGTTATG
ACTGAAAATGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAATGTTTCTATGACGATGGGCATCATCGTATC
AATTTTCCAACGCTTGCGTTCCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATG
GCAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCT
AGCAGCCACTCTGCCAACTCCATTCCTTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAG
GTGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAG
GATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCCGGCCATGTCTACGTTCGGACACGCAAC
GTCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGT
TTACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAA
AACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGAT
GATGCTAGCCTGGATACGTGTGCTATGGAACCCGACGATGAAAATGAAGACTCGGGTCGGGATAAAGAGGAGAAC
GCGATCTCTTCTTTTGGTTACGGACACGACTCGGATAATGAGGATGCCGAGGGAAGGGGTGAAGATGATGCGATT
GTAAATGACATTCGACTTCTCAGAGAAATGTGCGATGTCATCAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGT
CGTCTCGAGCACATGCATTTACGTCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTCCAACATCGCATTTCCG
GTTCACCGAGCTATATTGGGTGTGCGATCGAAGGTTTTGTGCGCCTTTTACCGCCTCTACAACGATATCCTGCCA
ATACTAAGCCGATATGCGGACCGGGATCCAACCAGGATCTCAACGTCGATTATCAATTCTTATGCTAAAGGGTTG
AAAATCAAAATGGATCCGGGGTTGATCAAGAACGAATTACAGGTACTTGGAAGGATGTTGGATTTGTCCGAGATG
TTGAAGGTTCTAGAGAGGCCTATTAAGTTGGATGTTAGGCCGACTTTGGCGAGGGATTTGAGCGAATTGTTCGAT
GTTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTGCTCCGCGAGCACTTTGTGAA
GATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGATCGAGATCGAATTTGTTC
AAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATTACGATGAAGGAGGG
CATGGAATCTTGAGGATTGACTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGAAGTTTATGTGTTGT
GGGTGTGATAAAGAGTTGTTTGAGCGGTTGGAATTCGTTGACGGCGTTGATGATCTGGTGGAATTTATGTTTGAA
GTCATGGCTGCTGCGAACGAATTACTCTTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATCCTAACCTATACC
TCACTCCACAATGCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATCGATCGCGTACAA
TCATTTATCACAGCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTAGATCTCCTCACC
CAATTATCGAATTACGCACAGGAAAAGCAGAAAGAGAAAGCACCGTTTGTTAGAGGTGGTGTGCTCGAGGAAGGG
GTTATGGAGAAATGGAGAAAGTGGGTTGAGGATCTGGATGTTCCGATACCTATTGTGCGGAGCAATAAACCTTGG
AAGGAGAAGAAAGGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAGGGGCTGAGGAGA
CCGCCGAGTGGGGATGATATATTCATCATGGATGATACGGATTTACTATCACCGCAACTGGGCTCGAGTAGCACG
CCTGGACCGGCATGGAAAGTCTACGTTGCGCCAAAGGTTGATATGAAAACTGTCATGGCTGAGGCTGCTGCCAGT
CAGATCAGACCTAGCAAGTCTAAAGAACCACTTCGGACACCTTCAAAATCTCAATTGGTACCACAATCACCACCA
CAAACAGCATCTAACGTGGGCTCAACTTCTTCGCCCCAGAGAGTTGTTCGAACATCGTCGTATCCCGGATCTCCC
CCGACGCCGTCTTTCCCGTCTTTGACTCCGCAGAAACAAAAGGAAGGTGTTGTTAGGCAGCAGCAGCAGCAGCAG
AATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTAGGGAATGTTTTGGGGGCGGCTGGTGGATCTGTGATGGGG
CCTACGATTACGCCTATGAGGATGCCTGCGGTGAATTTGAAGAGTGGGCAGCGAAGTGTTTCTGGTCCGAGTAAA
GCATGGGCATATACCCGTCCTATTGATCCCATACCACCCCCAGTCCTGATATCACCCACACCAACTCCCAACGAG
CCTTCTTCATCCACATTCAAAACGACAACAAAATCATTTCTGGCGATCCAACAAGAGGAAGAAGAACAGCAACAA
CAATTCGGAGATTTACAACGGGGAGATAAGAGATCGTTATTGGATATTCAGGAAGAGGAGAGGGCGAGGAGGCAA
GAGGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGAGATGGAGGTGGCACAGTCGAGT
GGTAGTGGTGGGAAATCGAAGAGAGGGGGTGGAAGAAAAGGTGGTGGGGAGAAAGGTGATAGACGTGGAGGAGGG
GGAGGGAGTGAAGGAAGTGGGAGGAGTGGACCTAAAGGACGTAAAGAAGGTAGAAAAGTTCAGAAGAACCCAGGC
GACAACAATGCTACTCCTCCATCATCATCTTCTACTCGACCACCACCACGGAATCATCGGAAAAACACTGCTCAA
GGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG
Transcript >AgabiH97|090010
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCATAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTCTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCAGCCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGAC
AATGAGGGCTACACCGCGTTCGACCTGTACAATTCTACCCTCGTCGGGACAAAGCCGTCTCCGGAAGAAATAGGT
GGTTATGCTGACCTATACACCTGGGGCACGAACGTAAATGCCGCTCTTGGGCTCGGGGATAGTAATGATAGGGCG
TATCCAGAACTAGCTGTCCTTCCTCGCAGAGAAGATGAGGCTGATTTGGAGAGACAAAGCTTATCGGCTCGATTC
TTGCCGATCAAGGCCGAGCATGTAGAGATGTCGAAGTTACACACTGTTGTTGTGACATCGGAAACTGGAGGAAAC
CTGCGTGTTTGTGGGTTTGGCAGTGGCGGAAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAACCTCTT
TCTCAACTCACGCAAGCCATTACCTCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAA
GTTCTCAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAA
GAACCTATACAGTATTCACCCAGGCGGGTTCAAGGTCCCTTGAGGAAGGAAGTTGTCAAAGGTGTCGCAGCTAGC
AAAGTCGCTTCGGCTTGTTGGACGGACGACGGCGTCTATACATGGGGAACGAATAACGGTCAGCTGGGATATGAC
AAAGCTGCCCAACCAGTTCAGGTCCAGCCGCGCAAAGTTTCGCGTTTAACGGTGTCTGTTATCTCGATCGTTATG
ACTGAAAATGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAATGTTTCTATGACGATGGGCATCATCGTATC
AATTTTCCAACGCTTGCGTTCCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATG
GCAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCT
AGCAGCCACTCTGCCAACTCCATTCCTTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAG
GTGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAG
GATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCCGGCCATGTCTACGTTCGGACACGCAAC
GTCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGT
TTACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAA
AACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGAT
GATGCTAGCCTGGATACGTGTGCTATGGAACCCGACGATGAAAATGAAGACTCGGGTCGGGATAAAGAGGAGAAC
GCGATCTCTTCTTTTGGTTACGGACACGACTCGGATAATGAGGATGCCGAGGGAAGGGGTGAAGATGATGCGATT
GTAAATGACATTCGACTTCTCAGAGAAATGTGCGATGTCATCAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGT
CGTCTCGAGCACATGCATTTACGTCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTCCAACATCGCATTTCCG
GTTCACCGAGCTATATTGGGTGTGCGATCGAAGGTTTTGTGCGCCTTTTACCGCCTCTACAACGATATCCTGCCA
ATACTAAGCCGATATGCGGACCGGGATCCAACCAGGATCTCAACGTCGATTATCAATTCTTATGCTAAAGGGTTG
AAAATCAAAATGGATCCGGGGTTGATCAAGAACGAATTACAGGTACTTGGAAGGATGTTGGATTTGTCCGAGATG
TTGAAGGTTCTAGAGAGGCCTATTAAGTTGGATGTTAGGCCGACTTTGGCGAGGGATTTGAGCGAATTGTTCGAT
GTTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTGCTCCGCGAGCACTTTGTGAA
GATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGATCGAGATCGAATTTGTTC
AAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATTACGATGAAGGAGGG
CATGGAATCTTGAGGATTGACTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGAAGTTTATGTGTTGT
GGGTGTGATAAAGAGTTGTTTGAGCGGTTGGAATTCGTTGACGGCGTTGATGATCTGGTGGAATTTATGTTTGAA
GTCATGGCTGCTGCGAACGAATTACTCTTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATCCTAACCTATACC
TCACTCCACAATGCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATCGATCGCGTACAA
TCATTTATCACAGCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTAGATCTCCTCACC
CAATTATCGAATTACGCACAGGAAAAGCAGAAAGAGAAAGCACCGTTTGTTAGAGGTGGTGTGCTCGAGGAAGGG
GTTATGGAGAAATGGAGAAAGTGGGTTGAGGATCTGGATGTTCCGATACCTATTGTGCGGAGCAATAAACCTTGG
AAGGAGAAGAAAGGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAGGGGCTGAGGAGA
CCGCCGAGTGGGGATGATATATTCATCATGGATGATACGGATTTACTATCACCGCAACTGGGCTCGAGTAGCACG
CCTGGACCGGCATGGAAAGTCTACGTTGCGCCAAAGGTTGATATGAAAACTGTCATGGCTGAGGCTGCTGCCAGT
CAGATCAGACCTAGCAAGTCTAAAGAACCACTTCGGACACCTTCAAAATCTCAATTGGTACCACAATCACCACCA
CAAACAGCATCTAACGTGGGCTCAACTTCTTCGCCCCAGAGAGTTGTTCGAACATCGTCGTATCCCGGATCTCCC
CCGACGCCGTCTTTCCCGTCTTTGACTCCGCAGAAACAAAAGGAAGGTGTTGTTAGGCAGCAGCAGCAGCAGCAG
AATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTAGGGAATGTTTTGGGGGCGGCTGGTGGATCTGTGATGGGG
CCTACGATTACGCCTATGAGGATGCCTGCGGTGAATTTGAAGAGTGGGCAGCGAAGTGTTTCTGGTCCGAGTAAA
GCATGGGCATATACCCGTCCTATTGATCCCATACCACCCCCAGTCCTGATATCACCCACACCAACTCCCAACGAG
CCTTCTTCATCCACATTCAAAACGACAACAAAATCATTTCTGGCGATCCAACAAGAGGAAGAAGAACAGCAACAA
CAATTCGGAGATTTACAACGGGGAGATAAGAGATCGTTATTGGATATTCAGGAAGAGGAGAGGGCGAGGAGGCAA
GAGGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGAGATGGAGGTGGCACAGTCGAGT
GGTAGTGGTGGGAAATCGAAGAGAGGGGGTGGAAGAAAAGGTGGTGGGGAGAAAGGTGATAGACGTGGAGGAGGG
GGAGGGAGTGAAGGAAGTGGGAGGAGTGGACCTAAAGGACGTAAAGAAGGTAGAAAAGTTCAGAAGAACCCAGGC
GACAACAATGCTACTCCTCCATCATCATCTTCTACTCGACCACCACCACGGAATCATCGGAAAAACACTGCTCAA
GGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG
Gene >AgabiH97|090010
ATGAGCTTGCTCCATGACGCATTCAACGCACGCAATCTCCATCTCTTCCAGCGCTTGGTGGATACCTCGAATGCC
GCAGACAAGTCCGCGTCGGTTTCTAGCACCAGTGTCGGCAAGGTCTCGAAGCATAGTTCGCTTGGTAACATAGAC
GTCAATCAGAGAGACTGGCTGGGCCGAACAGTTCTGCACCTCGCTTCGGCCGCCATCGAACATTTGGATTATGTT
CGGATTCTGCTCAAGCATCCCGCTATCAGCGTCAATGCTGCGGATACAGAAAGCCATTGGACTCCTCTCCATCGT
TCGCTGTATAGCGCTAATCTTCCAGCAGCGTAAGTGGAAATTACAGGCTTCTTCGTCATATCGGTTTCTTATCAT
CTCTGCAGCCGTCTCCTCCTTCAGCGTCCGGATATCGACATCTTCCTCAAAGACAATGAGGGCTACACCGCGTTC
GACCTGTACAATTCTACCCTCGTCGGGACAAAGCCGTCTCCGGAAGAAATAGGTGGTTATGCTGACCTATACACC
TGGGGCACGAACGTGTGTGTATCCGCTTTCCCCGGAATTCAAATGCATCAGCCCATTCACTCCCTTTCCCCCCCA
GAAATGCCGCTCTTGGGCTCGGGGATAGTAATGATAGGGCGTATCCAGAACTAGCTGTCCTTCCTCGCAGAGAAG
ATGAGGCTGATTTGGAGAGACAAAGCTTATCGGCTCGATTCTTGCCGATCAAGGCCGAGCATGTAGAGATGTCGA
AGTTACACACTGGTCTGTTACATGCTCATGACATCTATACATTATTAACATCTTGCCTTTAGTTGTTGTGACATC
GGAAACTGGAGGAAACCTGCGTGTTTGTGGGTTTGGCAGTGGCGGAAGGCGAGCCTATCTCAGCGATTCAGCGCA
TGGTAACTAATGCACATTTCATTCATTCAGGCTAGGACCCAACTCTCACACACAATACCTGCTTAAACCTCTTTC
TCAACTCACGCAAGCCATTACCTCGATCGCGTTGGGCCAAGACCACACTCTAGCTCTTACCAAAGCAGGTGAAGT
TCTCAGCTGGGGACTCAATCGATTCTCGCAACTGGGTTATCCTGTTGACCCGCCGACCAGCGGACGTCTCGAAGA
ACCTATACAGTATTCACCCAGGCGGGTTCAAGGTCCCTTGAGGAAGGAAGTTGTCAAAGGTGTCGCAGCTAGCAA
AGTCGCTTCGGCTTGTTGGACGGACGACGGCGTCTATACATGGGGAACGAATAACGGTCAGCTGGGTCAGTGTAG
CGTATATGAGAAATATGATTTTTCACTGATCTATTCTTAATTCTAGGATATGACAAAGCTGCCCAACCAGTTCAG
GTCCAGCCGCGCAAAGTTTCGCGTTTAACGGTGTCTGTTATCTCGATCGTTATGACTGTGAGTGTATCCCGGGAA
AGTTGTGCGGTATTCTAACCTGCTCCTGAAAGGAAAATGTAATGGCATGCCTTATGCAAAACCGACAAGTGGAAT
GTTTCTATGACGATGGGCATCATCGTATCAAGTCAGTTTCTTCCCTATAACTTTTCATGTCTAATCAGTGTAGCA
GTTTTCCAACGCTTGCGTTCCCATCGCCGATTCGTCCCTACCGTCCACCGCAAGCCGCTAAGGATTCTCGCATGG
CAAAGATCACATGCTGTGGTGACGTCTTTGCGGCGCTAACGTCGCACGGAGAGGTGTATATTTTCTCTCCATCTA
GCAGCCACTCTGCCAACTCCATTCCTTCTTCGTCATCTTCTGCCAACCTTTCCACTAGTTTTAATGATTCTGAGG
TGCCTACACGTATGGGCGGCCCATTCAAATGCCAACGCGTTTGGGCTCTACGTAAAAAGTTCAGCGCGGTCAAGG
ATGTCGCTTTAGGAGCGGACGGATCGATCATTATCTGTACCGAATCCGGCCATGTCTACGTTCGGACACGCAACG
TCAAGATGTCGTCTGTGGGCGGTTCTGGATCTTCAAGCAGCCAAAAAGCATTTAAATTCGTCAAGGTCCCTGGTT
TACAACGTGTTACGAGGGTTTGTGCTAGTGCCAGCGGCGCTTTTGGTGCTTTGAGAGTTGAATATAGGATGAAAA
ACGTTGAAGTGAAGGGAAATTTCGTTGCACAGGACTTGAGTCGTGTCCGACCTTGGTTGGAATCTGGGAAGGATG
ATGCTAGCCTGGATACGTGTGCTATGGAACCCGACGATGAAAATGAAGACTCGGGTCGGGATAAAGAGGAGAACG
CGATCTCTTCTTTTGGTTACGGACACGACTCGGATAATGAGGATGCCGAGGGAAGGGGTGAAGATGATGCGATTG
TAAATGACATTCGACTTCTCAGAGAAATGTGCGATGTCATCAAGAGAGAGGACAAGAGGAAAAAGGATGGGCGTC
GTCTCGAGCACATGCATTTACGTCATGGCGCAGACACCCTCCTCGTCCTAAGCTCTTCCAACATCGCATTTCCGG
TTCACCGAGCTATATTGGGTGTGCGATCGAAGGTTTTGTGCGGTATCCTTTCGACCAAGACGAAAAAGAAATCTT
TTGTATTGGATGAGCAAAGGAATATCAAAATTAGCCTTTTACCGCCTCTACAACGATATCCTGCCAATACTAAGC
CGATATGCGGACCGGGATCCAACCAGGTAACGCAACTATCCATCACAGGTGTCCATCCACTTTCGATTCTCATAC
TTCTTAATTATCTCTACTCCGACAATCTCGTGGCAATATGGGACCGTAGGATCTCAACGTCGATTATCAATTCTT
ATGCTAAAGGGTTGAAAATCAAAATGGATCCGGGGTTGATCAAGAACGAATTACAGGTACTTGGAAGGATGTTGG
ATTTGTCCGAGATGTTGAAGGTTCTAGAGAGGCCTATTAAGTTGGATGTTAGGCCGACTTTGGCGAGGGATTTGA
GCGAATTGTTCGATGTTGTCAATCTGGAGAGGGACGACGATGATGATGAGGGAGGGGTGGAGAAAGTTGCTCCGC
GAGCACTTTGTGAAGATGTTATACTGGAACTTGCGGATCGGGAAGTCTTCACGCATTCGGTGATCCTTAGATCGA
GATCGAATTTGTTCAAGAGCTTCTTTGATGAACCTGTTTGGACGCTGAACCGATGGGAGACGGAAGGCATCGATT
ACGATGAAGGAGGGCATGGAATCTTGAGGATTGACTTGAAACATTTGAAATGGCGGGTGATGGAATTTGTGCTGA
AGTTTATGTGTTGTGGGTGTGATAAAGAGTTGTTTGAGCGGTTGGAATTCGTTGACGGCGTTGATGATCTGGTGG
AATTTATGTTTGAAGTCATGGCTGCTGCGGTGTGTTCCTTCTCTGATTTTCGATGCTTTGACCCTAATTTTGTAC
CATAGAACGAATTACTCTTGGACCGCCTCGTCCTCCTTTGCTCAGAAGTTATCCTAACCTATACCTCACTCCACA
ATGCGTGCTATGTCCTTTATTTAGCGACCTATTACTCCGCCACGCAACTCATCGATCGCGTACAATCATTTATCA
CAGCGAATATGGAATTATTCCTTCAATCATACATGTTAGACGATATCCCTCTAGATCTCCTCACCCAATTATCGA
ATTACGCACAGGAAAAGCAGAAAGAGAAAGCACCGTTTGTTAGAGGTGGTGTGCTCGAGGAAGGGGTTATGGAGA
AATGGAGAAAGTGGGTTGAGGATCTGGATGTTCCGATACCTATTGTGCGGAGCAATAAACCTTGGAAGGAGAAGA
AAGGTTTGCCTTTACCTGATTTTGGGAAAGATAAGAGAGGAGGAAGGGAGAAGGGGCTGAGGAGACCGCCGAGTG
GGGATGATATATTCATCATGGATGATACGGATTTACTATCACCGCAACTGGGCTCGAGTAGCACGCCTGGACCGG
CATGGAAAGTCTACGTTGCGCCAAAGTATGCATCTTATTTTGGAGGGATACCCAACGCTAACGTTTGATTATAGG
GTTGATATGAAAACTGTCATGGCTGAGGCTGCTGCCAGTCAGATCAGACCTAGCAAGTCTAAAGAACCACTTCGG
ACACCTTCAAAATCTCAATTGGTACCACAATCACCACCACAAACAGCATCTAACGTGGGCTCAACTTCTTCGCCC
CAGAGAGTTGTTCGAACATCGTCGTATCCCGGATCTCCCCCGACGCCGTCTTTCCCGTCTTTGACTCCGCAGAAA
CAAAAGGAAGGTGTTGTTAGGCAGCAGCAGCAGCAGCAGAATGTTACTCCGACGAAACAGGGTGGTTCGAGTTTA
GGGAATGTTTTGGGGGCGGCTGGTGGATCTGTGATGGGGCCTACGATTACGCCTATGAGGATGCCTGCGGTGAAT
TTGAAGAGTGGGCAGCGAAGTGTTTCGTGCGTGTTTTGTTCTGTTGTGAAAGATATACCTATATCTAATTTTAAT
TTATTCTAGTGGTCCGAGTAAAGCATGGGCATATACCCGTCCTATTGATCCCATACCACCCCCAGTCCTGATATC
ACCCACACCAACTCCCAACGAGCCTTCTTCATCCACATTCAAAACGACAACAAAATCATTTCTGGCGATCCAACA
AGAGGAAGAAGAACAGCAACAACAATTCGGAGATTTACAACGGGGAGATAAGAGATCGTTATTGGATATTCAGGA
AGAGGAGAGGGCGAGGAGGCAAGAGGAGGAGTTTTTGAAGTGGTGGGAGGAGGAAGAGGTTAGGGTTAAGATGGA
GATGGAGGTGGCACAGTCGAGTGGTAGTGGTGGGAAATCGAAGAGAGGGGGTGGAAGAAAAGGTGGTGGGGAGAA
AGGTGATAGACGTGGAGGAGGGGGAGGGAGTGAAGGAAGTGGGAGGAGTGGACCTAAAGGACGTAAAGAAGGTAG
AAAAGTTCAGAAGAACCCAGGCGACAACAATGCTACTCCTCCATCATCATCTTCTACTCGACCACCACCACGGAA
TCATCGGAAAAACACTGCTCAAGGACAAGAACCTATTCTCCCCATGTCATCTGGATCTTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail