© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|089690 |
| Gene name | |
| Location | scaffold_6:345651..346356 |
| Strand | - |
| Gene length (bp) | 705 |
| Transcript length (bp) | 480 |
| Coding sequence length (bp) | 480 |
| Protein length (aa) | 160 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF00383 | dCMP_cyt_deam_1 | Cytidine and deoxycytidylate deaminase zinc-binding region | 3.8E-15 | 12 | 107 |
| PF08211 | dCMP_cyt_deam_2 | Cytidine and deoxycytidylate deaminase zinc-binding region | 2.6E-12 | 13 | 77 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9KD53|CDD_BACHD | Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 | 12 | 153 | 1.0E-40 |
| sp|Q9S3M0|CDD_SPOPS | Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 | 12 | 153 | 5.0E-40 |
| sp|P19079|CDD_BACSU | Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 | 12 | 158 | 5.0E-36 |
| sp|P56389|CDD_MOUSE | Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 | 11 | 154 | 1.0E-35 |
| sp|P32320|CDD_HUMAN | Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 | 5 | 154 | 2.0E-35 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|Q9KD53|CDD_BACHD | Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 | 12 | 153 | 1.0E-40 |
| sp|Q9S3M0|CDD_SPOPS | Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 | 12 | 153 | 5.0E-40 |
| sp|P19079|CDD_BACSU | Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 | 12 | 158 | 5.0E-36 |
| sp|P56389|CDD_MOUSE | Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 | 11 | 154 | 1.0E-35 |
| sp|P32320|CDD_HUMAN | Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 | 5 | 154 | 2.0E-35 |
| sp|Q09190|CDD_SCHPO | Putative cytidine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcd1 PE=3 SV=2 | 8 | 154 | 2.0E-31 |
| sp|Q06549|CDD_YEAST | Cytidine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDD1 PE=1 SV=1 | 10 | 154 | 2.0E-28 |
| sp|Q54I82|CDD_DICDI | Probable cytidine deaminase OS=Dictyostelium discoideum GN=cda PE=3 SV=1 | 8 | 153 | 1.0E-27 |
| sp|P9WPH3|CDD_MYCTU | Cytidine deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cdd PE=1 SV=1 | 1 | 158 | 1.0E-22 |
| sp|P9WPH2|CDD_MYCTO | Cytidine deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cdd PE=3 SV=1 | 1 | 158 | 1.0E-22 |
| sp|P47718|CDD_MYCPI | Cytidine deaminase OS=Mycoplasma pirum GN=cdd PE=3 SV=1 | 10 | 154 | 2.0E-16 |
| sp|P75051|CDD_MYCPN | Cytidine deaminase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=cdd PE=3 SV=1 | 22 | 136 | 7.0E-15 |
| sp|P47298|CDD_MYCGE | Cytidine deaminase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=cdd PE=3 SV=1 | 28 | 127 | 8.0E-14 |
| sp|Q5E4R6|CDD_VIBF1 | Cytidine deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cdd PE=3 SV=1 | 29 | 153 | 5.0E-11 |
| sp|B1IYC6|CDD_ECOLC | Cytidine deaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cdd PE=3 SV=1 | 29 | 155 | 6.0E-11 |
| sp|Q3Z062|CDD_SHISS | Cytidine deaminase OS=Shigella sonnei (strain Ss046) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|P0ABF7|CDD_SHIFL | Cytidine deaminase OS=Shigella flexneri GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q0T2Y0|CDD_SHIF8 | Cytidine deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q322V3|CDD_SHIBS | Cytidine deaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B2TVV2|CDD_SHIB3 | Cytidine deaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B1LKP0|CDD_ECOSM | Cytidine deaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B6I8J3|CDD_ECOSE | Cytidine deaminase OS=Escherichia coli (strain SE11) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|P0ABF6|CDD_ECOLI | Cytidine deaminase OS=Escherichia coli (strain K12) GN=cdd PE=1 SV=1 | 29 | 155 | 8.0E-11 |
| sp|A8A204|CDD_ECOHS | Cytidine deaminase OS=Escherichia coli O9:H4 (strain HS) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B1X7N2|CDD_ECODH | Cytidine deaminase OS=Escherichia coli (strain K12 / DH10B) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|C4ZSM3|CDD_ECOBW | Cytidine deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7M4Y8|CDD_ECO8A | Cytidine deaminase OS=Escherichia coli O8 (strain IAI1) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7LA09|CDD_ECO55 | Cytidine deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|A7ZNW5|CDD_ECO24 | Cytidine deaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q1R9T0|CDD_ECOUT | Cytidine deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7NCH2|CDD_ECOLU | Cytidine deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q8FFV3|CDD_ECOL6 | Cytidine deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q0TFU8|CDD_ECOL5 | Cytidine deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|A1AD04|CDD_ECOK1 | Cytidine deaminase OS=Escherichia coli O1:K1 / APEC GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7MXF5|CDD_ECO81 | Cytidine deaminase OS=Escherichia coli O81 (strain ED1a) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7MF55|CDD_ECO45 | Cytidine deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7UFF9|CDD_ECO27 | Cytidine deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|Q32EM3|CDD_SHIDS | Cytidine deaminase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|B7LVA3|CDD_ESCF3 | Cytidine deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cdd PE=3 SV=1 | 29 | 155 | 8.0E-11 |
| sp|C5BCM4|CDD_EDWI9 | Cytidine deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=cdd PE=3 SV=1 | 29 | 155 | 1.0E-10 |
| sp|B4ESY3|CDD_PROMH | Cytidine deaminase OS=Proteus mirabilis (strain HI4320) GN=cdd PE=3 SV=1 | 29 | 155 | 1.0E-10 |
| sp|B7NMA8|CDD_ECO7I | Cytidine deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cdd PE=3 SV=1 | 29 | 155 | 1.0E-10 |
| sp|Q66C79|CDD_YERPS | Cytidine deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cdd PE=3 SV=1 | 29 | 155 | 2.0E-10 |
| sp|B2JZJ6|CDD_YERPB | Cytidine deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cdd PE=3 SV=1 | 29 | 155 | 2.0E-10 |
| sp|B1JPZ5|CDD_YERPY | Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|A4TKN7|CDD_YERPP | Cytidine deaminase OS=Yersinia pestis (strain Pestoides F) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|Q1CGT5|CDD_YERPN | Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|A9R1B9|CDD_YERPG | Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|Q8ZG08|CDD_YERPE | Cytidine deaminase OS=Yersinia pestis GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|Q1C9U7|CDD_YERPA | Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|A7FJK3|CDD_YERP3 | Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cdd PE=3 SV=1 | 29 | 155 | 3.0E-10 |
| sp|Q8Z5A8|CDD_SALTI | Cytidine deaminase OS=Salmonella typhi GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B4SY15|CDD_SALNS | Cytidine deaminase OS=Salmonella newport (strain SL254) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B5EYN3|CDD_SALA4 | Cytidine deaminase OS=Salmonella agona (strain SL483) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B5FEN2|CDD_VIBFM | Cytidine deaminase OS=Vibrio fischeri (strain MJ11) GN=cdd PE=3 SV=1 | 29 | 153 | 3.0E-10 |
| sp|B5BE52|CDD_SALPK | Cytidine deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|Q5PE68|CDD_SALPA | Cytidine deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|Q57MF5|CDD_SALCH | Cytidine deaminase OS=Salmonella choleraesuis (strain SC-B67) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|Q8ZNM0|CDD_SALTY | Cytidine deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|C0Q0V4|CDD_SALPC | Cytidine deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|A9N6L3|CDD_SALPB | Cytidine deaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B4TAK5|CDD_SALHS | Cytidine deaminase OS=Salmonella heidelberg (strain SL476) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B5RC22|CDD_SALG2 | Cytidine deaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B5R153|CDD_SALEP | Cytidine deaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-10 |
| sp|B5FMZ9|CDD_SALDC | Cytidine deaminase OS=Salmonella dublin (strain CT_02021853) GN=cdd PE=3 SV=1 | 32 | 155 | 4.0E-10 |
| sp|B7VPF1|CDD_VIBTL | Cytidine deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=cdd PE=3 SV=1 | 11 | 153 | 4.0E-10 |
| sp|A5F1V7|CDD_VIBC3 | Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cdd PE=3 SV=1 | 27 | 153 | 4.0E-10 |
| sp|C3LLS7|CDD_VIBCM | Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cdd PE=3 SV=1 | 27 | 153 | 5.0E-10 |
| sp|Q9KSM5|CDD_VIBCH | Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cdd PE=1 SV=1 | 27 | 153 | 5.0E-10 |
| sp|Q6LRI0|CDD_PHOPR | Cytidine deaminase OS=Photobacterium profundum GN=cdd PE=3 SV=1 | 29 | 155 | 7.0E-10 |
| sp|B5YW75|CDD_ECO5E | Cytidine deaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cdd PE=3 SV=1 | 29 | 155 | 1.0E-09 |
| sp|Q8X648|CDD_ECO57 | Cytidine deaminase OS=Escherichia coli O157:H7 GN=cdd PE=3 SV=3 | 29 | 155 | 1.0E-09 |
| sp|B4TNP0|CDD_SALSV | Cytidine deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=cdd PE=3 SV=1 | 32 | 155 | 1.0E-09 |
| sp|A8GC32|CDD_SERP5 | Cytidine deaminase OS=Serratia proteamaculans (strain 568) GN=cdd PE=3 SV=1 | 30 | 155 | 1.0E-09 |
| sp|Q7MK48|CDD_VIBVY | Cytidine deaminase OS=Vibrio vulnificus (strain YJ016) GN=cdd PE=3 SV=2 | 27 | 153 | 1.0E-09 |
| sp|Q8DA31|CDD_VIBVU | Cytidine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=cdd PE=3 SV=2 | 27 | 153 | 2.0E-09 |
| sp|A9MKS5|CDD_SALAR | Cytidine deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cdd PE=3 SV=1 | 32 | 155 | 2.0E-09 |
| sp|A8AE87|CDD_CITK8 | Cytidine deaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cdd PE=3 SV=1 | 32 | 155 | 2.0E-09 |
| sp|A4WCI1|CDD_ENT38 | Cytidine deaminase OS=Enterobacter sp. (strain 638) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-09 |
| sp|B2VIF3|CDD_ERWT9 | Cytidine deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cdd PE=3 SV=1 | 29 | 155 | 5.0E-09 |
| sp|A7MLJ4|CDD_CROS8 | Cytidine deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cdd PE=3 SV=1 | 32 | 155 | 6.0E-09 |
| sp|Q65RG8|CDD_MANSM | Cytidine deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cdd PE=3 SV=1 | 29 | 155 | 2.0E-08 |
| sp|Q87Q52|CDD_VIBPA | Cytidine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cdd PE=3 SV=1 | 27 | 153 | 2.0E-08 |
| sp|P33967|BSR_BACCE | Blasticidin-S deaminase OS=Bacillus cereus GN=bsr PE=1 SV=1 | 6 | 148 | 3.0E-08 |
| sp|A6VLF5|CDD_ACTSZ | Cytidine deaminase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cdd PE=3 SV=1 | 29 | 157 | 4.0E-08 |
| sp|C6DDS7|CDD_PECCP | Cytidine deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cdd PE=3 SV=1 | 30 | 155 | 4.0E-08 |
| sp|A7MVH6|CDD_VIBCB | Cytidine deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cdd PE=3 SV=1 | 27 | 153 | 1.0E-07 |
| sp|Q7N6K3|CDD_PHOLL | Cytidine deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cdd PE=3 SV=1 | 29 | 153 | 2.0E-07 |
| sp|Q2NUD2|CDD_SODGM | Cytidine deaminase OS=Sodalis glossinidius (strain morsitans) GN=cdd PE=3 SV=1 | 29 | 155 | 2.0E-07 |
| sp|B0TQV3|CDD_SHEHH | Cytidine deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cdd PE=3 SV=1 | 30 | 155 | 2.0E-07 |
| sp|O65896|CDA1_ARATH | Cytidine deaminase 1 OS=Arabidopsis thaliana GN=CDA1 PE=1 SV=1 | 23 | 153 | 3.0E-07 |
| sp|A0KJH4|CDD_AERHH | Cytidine deaminase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cdd PE=3 SV=1 | 27 | 155 | 4.0E-07 |
| sp|Q083S7|CDD_SHEFN | Cytidine deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cdd PE=3 SV=1 | 30 | 155 | 4.0E-07 |
| sp|A4SNI2|CDD_AERS4 | Cytidine deaminase OS=Aeromonas salmonicida (strain A449) GN=cdd PE=3 SV=1 | 10 | 155 | 4.0E-07 |
| sp|B8CR83|CDD_SHEPW | Cytidine deaminase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cdd PE=3 SV=1 | 30 | 155 | 5.0E-07 |
| sp|Q3IBX5|CDD_PSEHT | Cytidine deaminase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cdd PE=3 SV=1 | 29 | 153 | 6.0E-07 |
| sp|Q87Q52|CDD_VIBPA | Cytidine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cdd PE=3 SV=1 | 1 | 116 | 1.0E-06 |
| sp|Q9SU87|CDA7_ARATH | Cytidine deaminase 7 OS=Arabidopsis thaliana GN=CDA7 PE=2 SV=1 | 15 | 157 | 1.0E-06 |
| sp|B1KRC5|CDD_SHEWM | Cytidine deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cdd PE=3 SV=1 | 30 | 155 | 2.0E-06 |
| sp|A8H5H1|CDD_SHEPA | Cytidine deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cdd PE=3 SV=1 | 30 | 155 | 3.0E-06 |
| sp|Q6D3B4|CDD_PECAS | Cytidine deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cdd PE=3 SV=1 | 32 | 155 | 3.0E-06 |
| sp|A8FWK2|CDD_SHESH | Cytidine deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=cdd PE=3 SV=1 | 30 | 155 | 3.0E-06 |
| sp|Q7MK48|CDD_VIBVY | Cytidine deaminase OS=Vibrio vulnificus (strain YJ016) GN=cdd PE=3 SV=2 | 1 | 113 | 6.0E-06 |
| sp|Q8DA31|CDD_VIBVU | Cytidine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=cdd PE=3 SV=2 | 1 | 113 | 6.0E-06 |
| sp|A1S723|CDD_SHEAM | Cytidine deaminase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cdd PE=3 SV=1 | 30 | 155 | 9.0E-06 |
| sp|Q9SU86|CDA6_ARATH | Cytidine deaminase 6 OS=Arabidopsis thaliana GN=CDA6 PE=3 SV=1 | 12 | 153 | 9.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0008270 | zinc ion binding | Yes |
| GO:0004126 | cytidine deaminase activity | Yes |
| GO:0009972 | cytidine deamination | Yes |
| GO:0008152 | metabolic process | No |
| GO:0055086 | nucleobase-containing small molecule metabolic process | No |
| GO:0072527 | pyrimidine-containing compound metabolic process | No |
| GO:0046087 | cytidine metabolic process | No |
| GO:0046131 | pyrimidine ribonucleoside metabolic process | No |
| GO:0072529 | pyrimidine-containing compound catabolic process | No |
| GO:0034656 | nucleobase-containing small molecule catabolic process | No |
| GO:0044281 | small molecule metabolic process | No |
| GO:0006139 | nucleobase-containing compound metabolic process | No |
| GO:0009056 | catabolic process | No |
| GO:0008150 | biological_process | No |
| GO:1901658 | glycosyl compound catabolic process | No |
| GO:0071704 | organic substance metabolic process | No |
| GO:1901565 | organonitrogen compound catabolic process | No |
| GO:0043169 | cation binding | No |
| GO:0019239 | deaminase activity | No |
| GO:0009119 | ribonucleoside metabolic process | No |
| GO:0044248 | cellular catabolic process | No |
| GO:0046872 | metal ion binding | No |
| GO:1901564 | organonitrogen compound metabolic process | No |
| GO:1901360 | organic cyclic compound metabolic process | No |
| GO:0043167 | ion binding | No |
| GO:0005488 | binding | No |
| GO:0016787 | hydrolase activity | No |
| GO:0046135 | pyrimidine nucleoside catabolic process | No |
| GO:1901657 | glycosyl compound metabolic process | No |
| GO:0044270 | cellular nitrogen compound catabolic process | No |
| GO:0034641 | cellular nitrogen compound metabolic process | No |
| GO:0019439 | aromatic compound catabolic process | No |
| GO:0044237 | cellular metabolic process | No |
| GO:0046133 | pyrimidine ribonucleoside catabolic process | No |
| GO:0003824 | catalytic activity | No |
| GO:0009116 | nucleoside metabolic process | No |
| GO:0009987 | cellular process | No |
| GO:0042454 | ribonucleoside catabolic process | No |
| GO:1901136 | carbohydrate derivative catabolic process | No |
| GO:0006213 | pyrimidine nucleoside metabolic process | No |
| GO:0006725 | cellular aromatic compound metabolic process | No |
| GO:0044238 | primary metabolic process | No |
| GO:0009164 | nucleoside catabolic process | No |
| GO:0006216 | cytidine catabolic process | No |
| GO:0034655 | nucleobase-containing compound catabolic process | No |
| GO:0003674 | molecular_function | No |
| GO:0046700 | heterocycle catabolic process | No |
| GO:1901135 | carbohydrate derivative metabolic process | No |
| GO:0016810 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds | No |
| GO:0006807 | nitrogen compound metabolic process | No |
| GO:0016814 | hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines | No |
| GO:0044282 | small molecule catabolic process | No |
| GO:1901361 | organic cyclic compound catabolic process | No |
| GO:1901575 | organic substance catabolic process | No |
| GO:0046483 | heterocycle metabolic process | No |
| GO:0046914 | transition metal ion binding | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| No | 1 - 20 | 0.45 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 339.49 | 200.43 | 478.54 |
| Initials | Initials knots | 293.96 | 175.83 | 412.10 |
| Pileal_Stipeal_center | Stage I stipe center | 164.17 | 94.72 | 233.61 |
| Pileal_Stipeal_shell | Stage I stipe shell | 141.67 | 80.95 | 202.39 |
| DIF_stipe_center | Stage II stipe center | 166.34 | 96.61 | 236.07 |
| DIF_stipe_shell | Stage II stipe shell | 183.93 | 106.96 | 260.89 |
| DIF_stipe_skin | Stage II stipe skin | 166.21 | 96.52 | 235.90 |
| DIF_cap_skin | Stage II cap skin | 134.90 | 77.19 | 192.61 |
| DIF_cap_tissue | Stage II cap tissue | 114.04 | 63.94 | 164.15 |
| DIF_gill_tissue | Stage II gill tissue | 110.00 | 60.95 | 159.06 |
| YFB_stipe_center | Young fruiting body stipe center | 262.67 | 154.14 | 371.20 |
| YFB_stipe_shell | Young fruiting body stipe shell | 263.60 | 157.20 | 370.00 |
| YFB_stipe_skin | Young fruiting body stipe skin | 194.51 | 113.72 | 275.29 |
| YFB_cap_skin | Young fruiting body cap skin | 200.26 | 118.20 | 282.32 |
| YFB_cap_tissue | Young fruiting body cap tissue | 127.13 | 71.38 | 182.88 |
| YFB_gill_tissue | Young fruiting body gill tissue | 171.05 | 98.68 | 243.41 |
| YFB_veil | Young fruiting body veil | 155.30 | 89.21 | 221.38 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.452955 | no |
| Casing | YFB_stipe_shell | 0.455839 | no |
| Casing | YFB_stipe_skin | 0.035993 | yes |
| Casing | YFB_cap_skin | 0.048212 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.007092 | yes |
| Casing | YFB_veil | 0.003765 | yes |
| Casing | Initials | 0.726149 | no |
| Casing | Pileal_Stipeal_center | 0.003765 | yes |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.006387 | yes |
| Casing | DIF_stipe_shell | 0.016386 | yes |
| Casing | DIF_stipe_skin | 0.005302 | yes |
| Casing | DIF_cap_skin | 0.001140 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.045487 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.032038 | yes |
| DIF_gill_tissue | YFB_cap_tissue | 0.757992 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.158092 | no |
| DIF_gill_tissue | YFB_veil | 0.315234 | no |
| YFB_stipe_center | YFB_stipe_shell | 0.993659 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.367256 | no |
| YFB_stipe_center | YFB_cap_skin | 0.419555 | no |
| YFB_stipe_center | YFB_cap_tissue | 0.009446 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.148512 | no |
| YFB_stipe_center | YFB_veil | 0.066584 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.354048 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.406835 | no |
| YFB_stipe_shell | YFB_cap_tissue | 0.009773 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.141946 | no |
| YFB_stipe_shell | YFB_veil | 0.064520 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.957005 | no |
| YFB_stipe_skin | YFB_cap_tissue | 0.178332 | no |
| YFB_stipe_skin | YFB_gill_tissue | 0.776605 | no |
| YFB_stipe_skin | YFB_veil | 0.546138 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.129965 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.706818 | no |
| YFB_cap_skin | YFB_veil | 0.470576 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.403475 | no |
| YFB_cap_tissue | YFB_veil | 0.628106 | no |
| YFB_gill_tissue | YFB_veil | 0.845446 | no |
| Initials | DIF_gill_tissue | 0.000613 | yes |
| Initials | YFB_stipe_center | 0.799248 | no |
| Initials | YFB_stipe_shell | 0.803002 | no |
| Initials | YFB_stipe_skin | 0.153971 | no |
| Initials | YFB_cap_skin | 0.185817 | no |
| Initials | YFB_cap_tissue | 0.001625 | yes |
| Initials | YFB_gill_tissue | 0.048834 | yes |
| Initials | YFB_veil | 0.021322 | yes |
| Initials | Pileal_Stipeal_center | 0.032504 | yes |
| Initials | Pileal_Stipeal_shell | 0.004928 | yes |
| Initials | DIF_stipe_center | 0.032038 | yes |
| Initials | DIF_stipe_shell | 0.090321 | no |
| Initials | DIF_stipe_skin | 0.031088 | yes |
| Initials | DIF_cap_skin | 0.002525 | yes |
| Initials | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.221377 | no |
| Pileal_Stipeal_center | YFB_stipe_center | 0.101705 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.100566 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.690174 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.607270 | no |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.500609 | no |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.942227 | no |
| Pileal_Stipeal_center | YFB_veil | 0.920493 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.742241 | no |
| Pileal_Stipeal_center | DIF_stipe_center | 0.981579 | no |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.810684 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.983111 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.625840 | no |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.270160 | no |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.510081 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.019987 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.016386 | yes |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.340971 | no |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.273153 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.826441 | no |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.643474 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.854020 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.704406 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.464638 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.705773 | no |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.929599 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.576268 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.194366 | no |
| DIF_stipe_center | YFB_stipe_center | 0.112576 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.110231 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.716231 | no |
| DIF_stipe_center | YFB_cap_skin | 0.634192 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.459815 | no |
| DIF_stipe_center | YFB_gill_tissue | 0.962135 | no |
| DIF_stipe_center | YFB_veil | 0.899057 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.836779 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.998441 | no |
| DIF_stipe_center | DIF_cap_skin | 0.590931 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.238213 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.085726 | no |
| DIF_stipe_shell | YFB_stipe_center | 0.255156 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.241805 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.918902 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.864045 | no |
| DIF_stipe_shell | YFB_cap_tissue | 0.259790 | no |
| DIF_stipe_shell | YFB_gill_tissue | 0.891825 | no |
| DIF_stipe_shell | YFB_veil | 0.689418 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.835271 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.351250 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.106659 | no |
| DIF_stipe_skin | DIF_gill_tissue | 0.194007 | no |
| DIF_stipe_skin | YFB_stipe_center | 0.109778 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.107767 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.714849 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.633782 | no |
| DIF_stipe_skin | YFB_cap_tissue | 0.463944 | no |
| DIF_stipe_skin | YFB_gill_tissue | 0.960455 | no |
| DIF_stipe_skin | YFB_veil | 0.899040 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.589930 | no |
| DIF_stipe_skin | DIF_cap_tissue | 0.235071 | no |
| DIF_cap_skin | DIF_gill_tissue | 0.625304 | no |
| DIF_cap_skin | YFB_stipe_center | 0.013782 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.012274 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.251327 | no |
| DIF_cap_skin | YFB_cap_skin | 0.192781 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.916469 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.527363 | no |
| DIF_cap_skin | YFB_veil | 0.756217 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.694418 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.953310 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.001140 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.001625 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.062610 | no |
| DIF_cap_tissue | YFB_cap_skin | 0.046952 | yes |
| DIF_cap_tissue | YFB_cap_tissue | 0.831120 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.198175 | no |
| DIF_cap_tissue | YFB_veil | 0.378147 | no |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|089690 MSSTAWTMSLEDRKRLIEAAFEAKNGTYSPYSKFPVGAALMAADGSIIKGANIENASYGATICAERTALVKAISE GVRSFVALAVTSNVKSAISPCGICRQFIREFCSLDMPILLVPGDYPQAGKSEPGYSEGGVRDTTLGELLPMSFGP EDLELPRRK* |
| Coding | >AgabiH97|089690 ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGCGAAAAAC GGAACGTACAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGG GCCAACATCGAAAATGCCTCTTACGGGGCAACTATTTGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCAGCGAA GGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC GAGGATCTCGAGTTACCTAGGAGGAAATAA |
| Transcript | >AgabiH97|089690 ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGCGAAAAAC GGAACGTACAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGG GCCAACATCGAAAATGCCTCTTACGGGGCAACTATTTGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCAGCGAA GGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC GAGGATCTCGAGTTACCTAGGAGGAAATAA |
| Gene | >AgabiH97|089690 ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGGTAACGAC GAGAATTATAGCCAATCGCTTATACTTGATGAGTTGACCTACATCCTTGGTCTCTATAGCGAAAAACGGAACGTA CAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGGGCCAACAT CGAAAATGCCTCTTACGGTGTGTTCTCATCCGATTCGCCCTCAACCATTGCTCATTCTTTTTAGGGGCAACTATT TGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCGTACGAATCCTCGGATTGTGTTACTTTTCCCATTAATCATAC TTTCCTTCTCAGAGCGAAGGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGGTTAGTTTGACTCTTGACTGCT CGTCTATAACCCTTCCACTCAATATCATCATTTAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC GAGGATCTCGAGTTACCTAGGAGGAAATAA |