Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089690
Gene name
Locationscaffold_6:345651..346356
Strand-
Gene length (bp)705
Transcript length (bp)480
Coding sequence length (bp)480
Protein length (aa) 160

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00383 dCMP_cyt_deam_1 Cytidine and deoxycytidylate deaminase zinc-binding region 3.8E-15 12 107
PF08211 dCMP_cyt_deam_2 Cytidine and deoxycytidylate deaminase zinc-binding region 2.6E-12 13 77

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q9KD53|CDD_BACHD Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 12 153 1.0E-40
sp|Q9S3M0|CDD_SPOPS Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 12 153 5.0E-40
sp|P19079|CDD_BACSU Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 12 158 5.0E-36
sp|P56389|CDD_MOUSE Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 11 154 1.0E-35
sp|P32320|CDD_HUMAN Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 5 154 2.0E-35
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q9KD53|CDD_BACHD Cytidine deaminase OS=Bacillus halodurans (strain ATCC BAA-125 / DSM 18197 / FERM 7344 / JCM 9153 / C-125) GN=cdd PE=3 SV=1 12 153 1.0E-40
sp|Q9S3M0|CDD_SPOPS Cytidine deaminase OS=Sporosarcina psychrophila GN=cdd PE=3 SV=1 12 153 5.0E-40
sp|P19079|CDD_BACSU Cytidine deaminase OS=Bacillus subtilis (strain 168) GN=cdd PE=1 SV=1 12 158 5.0E-36
sp|P56389|CDD_MOUSE Cytidine deaminase OS=Mus musculus GN=Cda PE=1 SV=2 11 154 1.0E-35
sp|P32320|CDD_HUMAN Cytidine deaminase OS=Homo sapiens GN=CDA PE=1 SV=2 5 154 2.0E-35
sp|Q09190|CDD_SCHPO Putative cytidine deaminase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=pcd1 PE=3 SV=2 8 154 2.0E-31
sp|Q06549|CDD_YEAST Cytidine deaminase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=CDD1 PE=1 SV=1 10 154 2.0E-28
sp|Q54I82|CDD_DICDI Probable cytidine deaminase OS=Dictyostelium discoideum GN=cda PE=3 SV=1 8 153 1.0E-27
sp|P9WPH3|CDD_MYCTU Cytidine deaminase OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) GN=cdd PE=1 SV=1 1 158 1.0E-22
sp|P9WPH2|CDD_MYCTO Cytidine deaminase OS=Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh) GN=cdd PE=3 SV=1 1 158 1.0E-22
sp|P47718|CDD_MYCPI Cytidine deaminase OS=Mycoplasma pirum GN=cdd PE=3 SV=1 10 154 2.0E-16
sp|P75051|CDD_MYCPN Cytidine deaminase OS=Mycoplasma pneumoniae (strain ATCC 29342 / M129) GN=cdd PE=3 SV=1 22 136 7.0E-15
sp|P47298|CDD_MYCGE Cytidine deaminase OS=Mycoplasma genitalium (strain ATCC 33530 / G-37 / NCTC 10195) GN=cdd PE=3 SV=1 28 127 8.0E-14
sp|Q5E4R6|CDD_VIBF1 Cytidine deaminase OS=Vibrio fischeri (strain ATCC 700601 / ES114) GN=cdd PE=3 SV=1 29 153 5.0E-11
sp|B1IYC6|CDD_ECOLC Cytidine deaminase OS=Escherichia coli (strain ATCC 8739 / DSM 1576 / Crooks) GN=cdd PE=3 SV=1 29 155 6.0E-11
sp|Q3Z062|CDD_SHISS Cytidine deaminase OS=Shigella sonnei (strain Ss046) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|P0ABF7|CDD_SHIFL Cytidine deaminase OS=Shigella flexneri GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q0T2Y0|CDD_SHIF8 Cytidine deaminase OS=Shigella flexneri serotype 5b (strain 8401) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q322V3|CDD_SHIBS Cytidine deaminase OS=Shigella boydii serotype 4 (strain Sb227) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B2TVV2|CDD_SHIB3 Cytidine deaminase OS=Shigella boydii serotype 18 (strain CDC 3083-94 / BS512) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B1LKP0|CDD_ECOSM Cytidine deaminase OS=Escherichia coli (strain SMS-3-5 / SECEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B6I8J3|CDD_ECOSE Cytidine deaminase OS=Escherichia coli (strain SE11) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|P0ABF6|CDD_ECOLI Cytidine deaminase OS=Escherichia coli (strain K12) GN=cdd PE=1 SV=1 29 155 8.0E-11
sp|A8A204|CDD_ECOHS Cytidine deaminase OS=Escherichia coli O9:H4 (strain HS) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B1X7N2|CDD_ECODH Cytidine deaminase OS=Escherichia coli (strain K12 / DH10B) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|C4ZSM3|CDD_ECOBW Cytidine deaminase OS=Escherichia coli (strain K12 / MC4100 / BW2952) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7M4Y8|CDD_ECO8A Cytidine deaminase OS=Escherichia coli O8 (strain IAI1) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7LA09|CDD_ECO55 Cytidine deaminase OS=Escherichia coli (strain 55989 / EAEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|A7ZNW5|CDD_ECO24 Cytidine deaminase OS=Escherichia coli O139:H28 (strain E24377A / ETEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q1R9T0|CDD_ECOUT Cytidine deaminase OS=Escherichia coli (strain UTI89 / UPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7NCH2|CDD_ECOLU Cytidine deaminase OS=Escherichia coli O17:K52:H18 (strain UMN026 / ExPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q8FFV3|CDD_ECOL6 Cytidine deaminase OS=Escherichia coli O6:H1 (strain CFT073 / ATCC 700928 / UPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q0TFU8|CDD_ECOL5 Cytidine deaminase OS=Escherichia coli O6:K15:H31 (strain 536 / UPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|A1AD04|CDD_ECOK1 Cytidine deaminase OS=Escherichia coli O1:K1 / APEC GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7MXF5|CDD_ECO81 Cytidine deaminase OS=Escherichia coli O81 (strain ED1a) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7MF55|CDD_ECO45 Cytidine deaminase OS=Escherichia coli O45:K1 (strain S88 / ExPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7UFF9|CDD_ECO27 Cytidine deaminase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|Q32EM3|CDD_SHIDS Cytidine deaminase OS=Shigella dysenteriae serotype 1 (strain Sd197) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|B7LVA3|CDD_ESCF3 Cytidine deaminase OS=Escherichia fergusonii (strain ATCC 35469 / DSM 13698 / CDC 0568-73) GN=cdd PE=3 SV=1 29 155 8.0E-11
sp|C5BCM4|CDD_EDWI9 Cytidine deaminase OS=Edwardsiella ictaluri (strain 93-146) GN=cdd PE=3 SV=1 29 155 1.0E-10
sp|B4ESY3|CDD_PROMH Cytidine deaminase OS=Proteus mirabilis (strain HI4320) GN=cdd PE=3 SV=1 29 155 1.0E-10
sp|B7NMA8|CDD_ECO7I Cytidine deaminase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=cdd PE=3 SV=1 29 155 1.0E-10
sp|Q66C79|CDD_YERPS Cytidine deaminase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=cdd PE=3 SV=1 29 155 2.0E-10
sp|B2JZJ6|CDD_YERPB Cytidine deaminase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=cdd PE=3 SV=1 29 155 2.0E-10
sp|B1JPZ5|CDD_YERPY Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|A4TKN7|CDD_YERPP Cytidine deaminase OS=Yersinia pestis (strain Pestoides F) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|Q1CGT5|CDD_YERPN Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|A9R1B9|CDD_YERPG Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|Q8ZG08|CDD_YERPE Cytidine deaminase OS=Yersinia pestis GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|Q1C9U7|CDD_YERPA Cytidine deaminase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|A7FJK3|CDD_YERP3 Cytidine deaminase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=cdd PE=3 SV=1 29 155 3.0E-10
sp|Q8Z5A8|CDD_SALTI Cytidine deaminase OS=Salmonella typhi GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B4SY15|CDD_SALNS Cytidine deaminase OS=Salmonella newport (strain SL254) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B5EYN3|CDD_SALA4 Cytidine deaminase OS=Salmonella agona (strain SL483) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B5FEN2|CDD_VIBFM Cytidine deaminase OS=Vibrio fischeri (strain MJ11) GN=cdd PE=3 SV=1 29 153 3.0E-10
sp|B5BE52|CDD_SALPK Cytidine deaminase OS=Salmonella paratyphi A (strain AKU_12601) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|Q5PE68|CDD_SALPA Cytidine deaminase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|Q57MF5|CDD_SALCH Cytidine deaminase OS=Salmonella choleraesuis (strain SC-B67) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|Q8ZNM0|CDD_SALTY Cytidine deaminase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|C0Q0V4|CDD_SALPC Cytidine deaminase OS=Salmonella paratyphi C (strain RKS4594) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|A9N6L3|CDD_SALPB Cytidine deaminase OS=Salmonella paratyphi B (strain ATCC BAA-1250 / SPB7) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B4TAK5|CDD_SALHS Cytidine deaminase OS=Salmonella heidelberg (strain SL476) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B5RC22|CDD_SALG2 Cytidine deaminase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B5R153|CDD_SALEP Cytidine deaminase OS=Salmonella enteritidis PT4 (strain P125109) GN=cdd PE=3 SV=1 32 155 3.0E-10
sp|B5FMZ9|CDD_SALDC Cytidine deaminase OS=Salmonella dublin (strain CT_02021853) GN=cdd PE=3 SV=1 32 155 4.0E-10
sp|B7VPF1|CDD_VIBTL Cytidine deaminase OS=Vibrio tasmaniensis (strain LGP32) GN=cdd PE=3 SV=1 11 153 4.0E-10
sp|A5F1V7|CDD_VIBC3 Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39541 / Classical Ogawa 395 / O395) GN=cdd PE=3 SV=1 27 153 4.0E-10
sp|C3LLS7|CDD_VIBCM Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain M66-2) GN=cdd PE=3 SV=1 27 153 5.0E-10
sp|Q9KSM5|CDD_VIBCH Cytidine deaminase OS=Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) GN=cdd PE=1 SV=1 27 153 5.0E-10
sp|Q6LRI0|CDD_PHOPR Cytidine deaminase OS=Photobacterium profundum GN=cdd PE=3 SV=1 29 155 7.0E-10
sp|B5YW75|CDD_ECO5E Cytidine deaminase OS=Escherichia coli O157:H7 (strain EC4115 / EHEC) GN=cdd PE=3 SV=1 29 155 1.0E-09
sp|Q8X648|CDD_ECO57 Cytidine deaminase OS=Escherichia coli O157:H7 GN=cdd PE=3 SV=3 29 155 1.0E-09
sp|B4TNP0|CDD_SALSV Cytidine deaminase OS=Salmonella schwarzengrund (strain CVM19633) GN=cdd PE=3 SV=1 32 155 1.0E-09
sp|A8GC32|CDD_SERP5 Cytidine deaminase OS=Serratia proteamaculans (strain 568) GN=cdd PE=3 SV=1 30 155 1.0E-09
sp|Q7MK48|CDD_VIBVY Cytidine deaminase OS=Vibrio vulnificus (strain YJ016) GN=cdd PE=3 SV=2 27 153 1.0E-09
sp|Q8DA31|CDD_VIBVU Cytidine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=cdd PE=3 SV=2 27 153 2.0E-09
sp|A9MKS5|CDD_SALAR Cytidine deaminase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=cdd PE=3 SV=1 32 155 2.0E-09
sp|A8AE87|CDD_CITK8 Cytidine deaminase OS=Citrobacter koseri (strain ATCC BAA-895 / CDC 4225-83 / SGSC4696) GN=cdd PE=3 SV=1 32 155 2.0E-09
sp|A4WCI1|CDD_ENT38 Cytidine deaminase OS=Enterobacter sp. (strain 638) GN=cdd PE=3 SV=1 32 155 3.0E-09
sp|B2VIF3|CDD_ERWT9 Cytidine deaminase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=cdd PE=3 SV=1 29 155 5.0E-09
sp|A7MLJ4|CDD_CROS8 Cytidine deaminase OS=Cronobacter sakazakii (strain ATCC BAA-894) GN=cdd PE=3 SV=1 32 155 6.0E-09
sp|Q65RG8|CDD_MANSM Cytidine deaminase OS=Mannheimia succiniciproducens (strain MBEL55E) GN=cdd PE=3 SV=1 29 155 2.0E-08
sp|Q87Q52|CDD_VIBPA Cytidine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cdd PE=3 SV=1 27 153 2.0E-08
sp|P33967|BSR_BACCE Blasticidin-S deaminase OS=Bacillus cereus GN=bsr PE=1 SV=1 6 148 3.0E-08
sp|A6VLF5|CDD_ACTSZ Cytidine deaminase OS=Actinobacillus succinogenes (strain ATCC 55618 / 130Z) GN=cdd PE=3 SV=1 29 157 4.0E-08
sp|C6DDS7|CDD_PECCP Cytidine deaminase OS=Pectobacterium carotovorum subsp. carotovorum (strain PC1) GN=cdd PE=3 SV=1 30 155 4.0E-08
sp|A7MVH6|CDD_VIBCB Cytidine deaminase OS=Vibrio campbellii (strain ATCC BAA-1116 / BB120) GN=cdd PE=3 SV=1 27 153 1.0E-07
sp|Q7N6K3|CDD_PHOLL Cytidine deaminase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=cdd PE=3 SV=1 29 153 2.0E-07
sp|Q2NUD2|CDD_SODGM Cytidine deaminase OS=Sodalis glossinidius (strain morsitans) GN=cdd PE=3 SV=1 29 155 2.0E-07
sp|B0TQV3|CDD_SHEHH Cytidine deaminase OS=Shewanella halifaxensis (strain HAW-EB4) GN=cdd PE=3 SV=1 30 155 2.0E-07
sp|O65896|CDA1_ARATH Cytidine deaminase 1 OS=Arabidopsis thaliana GN=CDA1 PE=1 SV=1 23 153 3.0E-07
sp|A0KJH4|CDD_AERHH Cytidine deaminase OS=Aeromonas hydrophila subsp. hydrophila (strain ATCC 7966 / DSM 30187 / JCM 1027 / KCTC 2358 / NCIMB 9240) GN=cdd PE=3 SV=1 27 155 4.0E-07
sp|Q083S7|CDD_SHEFN Cytidine deaminase OS=Shewanella frigidimarina (strain NCIMB 400) GN=cdd PE=3 SV=1 30 155 4.0E-07
sp|A4SNI2|CDD_AERS4 Cytidine deaminase OS=Aeromonas salmonicida (strain A449) GN=cdd PE=3 SV=1 10 155 4.0E-07
sp|B8CR83|CDD_SHEPW Cytidine deaminase OS=Shewanella piezotolerans (strain WP3 / JCM 13877) GN=cdd PE=3 SV=1 30 155 5.0E-07
sp|Q3IBX5|CDD_PSEHT Cytidine deaminase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=cdd PE=3 SV=1 29 153 6.0E-07
sp|Q87Q52|CDD_VIBPA Cytidine deaminase OS=Vibrio parahaemolyticus serotype O3:K6 (strain RIMD 2210633) GN=cdd PE=3 SV=1 1 116 1.0E-06
sp|Q9SU87|CDA7_ARATH Cytidine deaminase 7 OS=Arabidopsis thaliana GN=CDA7 PE=2 SV=1 15 157 1.0E-06
sp|B1KRC5|CDD_SHEWM Cytidine deaminase OS=Shewanella woodyi (strain ATCC 51908 / MS32) GN=cdd PE=3 SV=1 30 155 2.0E-06
sp|A8H5H1|CDD_SHEPA Cytidine deaminase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=cdd PE=3 SV=1 30 155 3.0E-06
sp|Q6D3B4|CDD_PECAS Cytidine deaminase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=cdd PE=3 SV=1 32 155 3.0E-06
sp|A8FWK2|CDD_SHESH Cytidine deaminase OS=Shewanella sediminis (strain HAW-EB3) GN=cdd PE=3 SV=1 30 155 3.0E-06
sp|Q7MK48|CDD_VIBVY Cytidine deaminase OS=Vibrio vulnificus (strain YJ016) GN=cdd PE=3 SV=2 1 113 6.0E-06
sp|Q8DA31|CDD_VIBVU Cytidine deaminase OS=Vibrio vulnificus (strain CMCP6) GN=cdd PE=3 SV=2 1 113 6.0E-06
sp|A1S723|CDD_SHEAM Cytidine deaminase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=cdd PE=3 SV=1 30 155 9.0E-06
sp|Q9SU86|CDA6_ARATH Cytidine deaminase 6 OS=Arabidopsis thaliana GN=CDA6 PE=3 SV=1 12 153 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008270 zinc ion binding Yes
GO:0004126 cytidine deaminase activity Yes
GO:0009972 cytidine deamination Yes
GO:0008152 metabolic process No
GO:0055086 nucleobase-containing small molecule metabolic process No
GO:0072527 pyrimidine-containing compound metabolic process No
GO:0046087 cytidine metabolic process No
GO:0046131 pyrimidine ribonucleoside metabolic process No
GO:0072529 pyrimidine-containing compound catabolic process No
GO:0034656 nucleobase-containing small molecule catabolic process No
GO:0044281 small molecule metabolic process No
GO:0006139 nucleobase-containing compound metabolic process No
GO:0009056 catabolic process No
GO:0008150 biological_process No
GO:1901658 glycosyl compound catabolic process No
GO:0071704 organic substance metabolic process No
GO:1901565 organonitrogen compound catabolic process No
GO:0043169 cation binding No
GO:0019239 deaminase activity No
GO:0009119 ribonucleoside metabolic process No
GO:0044248 cellular catabolic process No
GO:0046872 metal ion binding No
GO:1901564 organonitrogen compound metabolic process No
GO:1901360 organic cyclic compound metabolic process No
GO:0043167 ion binding No
GO:0005488 binding No
GO:0016787 hydrolase activity No
GO:0046135 pyrimidine nucleoside catabolic process No
GO:1901657 glycosyl compound metabolic process No
GO:0044270 cellular nitrogen compound catabolic process No
GO:0034641 cellular nitrogen compound metabolic process No
GO:0019439 aromatic compound catabolic process No
GO:0044237 cellular metabolic process No
GO:0046133 pyrimidine ribonucleoside catabolic process No
GO:0003824 catalytic activity No
GO:0009116 nucleoside metabolic process No
GO:0009987 cellular process No
GO:0042454 ribonucleoside catabolic process No
GO:1901136 carbohydrate derivative catabolic process No
GO:0006213 pyrimidine nucleoside metabolic process No
GO:0006725 cellular aromatic compound metabolic process No
GO:0044238 primary metabolic process No
GO:0009164 nucleoside catabolic process No
GO:0006216 cytidine catabolic process No
GO:0034655 nucleobase-containing compound catabolic process No
GO:0003674 molecular_function No
GO:0046700 heterocycle catabolic process No
GO:1901135 carbohydrate derivative metabolic process No
GO:0016810 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds No
GO:0006807 nitrogen compound metabolic process No
GO:0016814 hydrolase activity, acting on carbon-nitrogen (but not peptide) bonds, in cyclic amidines No
GO:0044282 small molecule catabolic process No
GO:1901361 organic cyclic compound catabolic process No
GO:1901575 organic substance catabolic process No
GO:0046483 heterocycle metabolic process No
GO:0046914 transition metal ion binding No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 20 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089690
MSSTAWTMSLEDRKRLIEAAFEAKNGTYSPYSKFPVGAALMAADGSIIKGANIENASYGATICAERTALVKAISE
GVRSFVALAVTSNVKSAISPCGICRQFIREFCSLDMPILLVPGDYPQAGKSEPGYSEGGVRDTTLGELLPMSFGP
EDLELPRRK*
Coding >AgabiH97|089690
ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGCGAAAAAC
GGAACGTACAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGG
GCCAACATCGAAAATGCCTCTTACGGGGCAACTATTTGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCAGCGAA
GGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC
CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA
TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC
GAGGATCTCGAGTTACCTAGGAGGAAATAA
Transcript >AgabiH97|089690
ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGCGAAAAAC
GGAACGTACAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGG
GCCAACATCGAAAATGCCTCTTACGGGGCAACTATTTGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCAGCGAA
GGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC
CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA
TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC
GAGGATCTCGAGTTACCTAGGAGGAAATAA
Gene >AgabiH97|089690
ATGAGTTCCACGGCTTGGACAATGTCTCTTGAAGACCGAAAGAGGCTCATTGAAGCTGCATTCGAAGGTAACGAC
GAGAATTATAGCCAATCGCTTATACTTGATGAGTTGACCTACATCCTTGGTCTCTATAGCGAAAAACGGAACGTA
CAGTCCCTACTCCAAGTTTCCTGTGGGTGCTGCCCTAATGGCTGCGGATGGCAGCATTATCAAGGGGGCCAACAT
CGAAAATGCCTCTTACGGTGTGTTCTCATCCGATTCGCCCTCAACCATTGCTCATTCTTTTTAGGGGCAACTATT
TGTGCCGAGCGGACCGCCCTTGTCAAAGCGATCGTACGAATCCTCGGATTGTGTTACTTTTCCCATTAATCATAC
TTTCCTTCTCAGAGCGAAGGAGTCCGGTCGTTTGTAGCACTTGCAGTCACAAGGTTAGTTTGACTCTTGACTGCT
CGTCTATAACCCTTCCACTCAATATCATCATTTAGCAACGTGAAGTCAGCAATATCACCCTGTGGGATATGTCGC
CAGTTCATAAGAGAATTTTGTTCTTTGGATATGCCCATTTTACTCGTACCAGGTGATTATCCACAGGCCGGAAAA
TCAGAACCAGGGTACTCGGAGGGTGGTGTTCGTGATACCACTTTGGGTGAGCTCTTGCCTATGAGCTTCGGTCCC
GAGGATCTCGAGTTACCTAGGAGGAAATAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail