© 2022 - Robin Ohm - Utrecht University - The Netherlands
Built with Python Django and Wagtail
| Protein ID | AgabiH97|089660 |
| Gene name | |
| Location | scaffold_6:338716..339156 |
| Strand | - |
| Gene length (bp) | 440 |
| Transcript length (bp) | 339 |
| Coding sequence length (bp) | 339 |
| Protein length (aa) | 113 |
| PFAM Domain ID | Short name | Long name | E-value | Start | End |
|---|---|---|---|---|---|
| PF01185 | Hydrophobin | Fungal hydrophobin | 1.8E-15 | 31 | 108 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O13300|HYP3_AGABI | Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 | 1 | 112 | 2.0E-34 |
| sp|P04158|SC1_SCHCO | Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 | 9 | 108 | 2.0E-18 |
| sp|O74300|SC6_SCHCO | Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 | 26 | 106 | 7.0E-11 |
| sp|P16933|SC3_SCHCO | Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 | 1 | 108 | 4.0E-10 |
| sp|P49072|HYP1_AGABI | Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 | 1 | 112 | 1.0E-08 |
| Swissprot ID | Swissprot Description | Start | End | E-value |
|---|---|---|---|---|
| sp|O13300|HYP3_AGABI | Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 | 1 | 112 | 2.0E-34 |
| sp|P04158|SC1_SCHCO | Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 | 9 | 108 | 2.0E-18 |
| sp|O74300|SC6_SCHCO | Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 | 26 | 106 | 7.0E-11 |
| sp|P16933|SC3_SCHCO | Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 | 1 | 108 | 4.0E-10 |
| sp|P49072|HYP1_AGABI | Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 | 1 | 112 | 1.0E-08 |
| sp|P49073|HYP2_AGABI | Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 | 1 | 112 | 6.0E-07 |
| sp|O43122|HYP4_AGABI | Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 | 26 | 112 | 1.0E-06 |
| sp|P16934|SC4_SCHCO | Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 | 31 | 110 | 8.0E-06 |
| GO Term | Description | Terminal node |
|---|---|---|
| GO:0005199 | structural constituent of cell wall | Yes |
| GO:0009277 | fungal-type cell wall | Yes |
| GO:0005575 | cellular_component | No |
| GO:0003674 | molecular_function | No |
| GO:0005618 | cell wall | No |
| GO:0030312 | external encapsulating structure | No |
| GO:0005198 | structural molecule activity | No |
| GO:0110165 | cellular anatomical entity | No |
| SignalP signal predicted | Location (based on Ymax) |
D score (significance: > 0.45) |
|---|---|---|
| Yes | 1 - 23 | 0.45 |
| Domain # | Start | End | Length |
|---|---|---|---|
| 1 | 5 | 24 | 19 |
| 2 | 49 | 71 | 22 |
Expression values
| Label | Description | Expression (RPKM) | Confidence interval (low) | Confidence interval (high) |
|---|---|---|---|---|
| Casing | Casing mycelium | 82.61 | 35.22 | 129.99 |
| Initials | Initials knots | 52.87 | 23.98 | 81.76 |
| Pileal_Stipeal_center | Stage I stipe center | 63.06 | 26.76 | 99.36 |
| Pileal_Stipeal_shell | Stage I stipe shell | 23.46 | 8.91 | 38.02 |
| DIF_stipe_center | Stage II stipe center | 29.08 | 11.68 | 46.47 |
| DIF_stipe_shell | Stage II stipe shell | 44.70 | 19.51 | 69.90 |
| DIF_stipe_skin | Stage II stipe skin | 68.67 | 31.87 | 105.46 |
| DIF_cap_skin | Stage II cap skin | 20.10 | 7.32 | 32.87 |
| DIF_cap_tissue | Stage II cap tissue | 14.18 | 4.49 | 23.86 |
| DIF_gill_tissue | Stage II gill tissue | 14.41 | 4.60 | 24.22 |
| YFB_stipe_center | Young fruiting body stipe center | 56.07 | 25.42 | 86.71 |
| YFB_stipe_shell | Young fruiting body stipe shell | 47.87 | 20.88 | 74.86 |
| YFB_stipe_skin | Young fruiting body stipe skin | 51.41 | 23.14 | 79.67 |
| YFB_cap_skin | Young fruiting body cap skin | 18.09 | 6.42 | 29.77 |
| YFB_cap_tissue | Young fruiting body cap tissue | 7.89 | 1.74 | 14.04 |
| YFB_gill_tissue | Young fruiting body gill tissue | 50.29 | 18.03 | 82.55 |
| YFB_veil | Young fruiting body veil | 35.80 | 13.13 | 58.47 |
Differential expression
| Label1 | Label2 | Q-value | Significant difference |
|---|---|---|---|
| Casing | DIF_gill_tissue | 0.000613 | yes |
| Casing | YFB_stipe_center | 0.395889 | no |
| Casing | YFB_stipe_shell | 0.191804 | no |
| Casing | YFB_stipe_skin | 0.261752 | no |
| Casing | YFB_cap_skin | 0.000613 | yes |
| Casing | YFB_cap_tissue | 0.000613 | yes |
| Casing | YFB_gill_tissue | 0.295810 | no |
| Casing | YFB_veil | 0.037140 | yes |
| Casing | Initials | 0.299456 | no |
| Casing | Pileal_Stipeal_center | 0.613707 | no |
| Casing | Pileal_Stipeal_shell | 0.000613 | yes |
| Casing | DIF_stipe_center | 0.001625 | yes |
| Casing | DIF_stipe_shell | 0.121416 | no |
| Casing | DIF_stipe_skin | 0.758030 | no |
| Casing | DIF_cap_skin | 0.000613 | yes |
| Casing | DIF_cap_tissue | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_gill_tissue | YFB_stipe_shell | 0.004160 | yes |
| DIF_gill_tissue | YFB_stipe_skin | 0.002525 | yes |
| DIF_gill_tissue | YFB_cap_skin | 0.752285 | no |
| DIF_gill_tissue | YFB_cap_tissue | 0.307674 | no |
| DIF_gill_tissue | YFB_gill_tissue | 0.004928 | yes |
| DIF_gill_tissue | YFB_veil | 0.038720 | yes |
| YFB_stipe_center | YFB_stipe_shell | 0.801661 | no |
| YFB_stipe_center | YFB_stipe_skin | 0.899518 | no |
| YFB_stipe_center | YFB_cap_skin | 0.003765 | yes |
| YFB_stipe_center | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_center | YFB_gill_tissue | 0.881271 | no |
| YFB_stipe_center | YFB_veil | 0.348877 | no |
| YFB_stipe_shell | YFB_stipe_skin | 0.923455 | no |
| YFB_stipe_shell | YFB_cap_skin | 0.011041 | yes |
| YFB_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_shell | YFB_gill_tissue | 0.953149 | no |
| YFB_stipe_shell | YFB_veil | 0.609648 | no |
| YFB_stipe_skin | YFB_cap_skin | 0.005302 | yes |
| YFB_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| YFB_stipe_skin | YFB_gill_tissue | 0.978733 | no |
| YFB_stipe_skin | YFB_veil | 0.476780 | no |
| YFB_cap_skin | YFB_cap_tissue | 0.112576 | no |
| YFB_cap_skin | YFB_gill_tissue | 0.014081 | yes |
| YFB_cap_skin | YFB_veil | 0.131265 | no |
| YFB_cap_tissue | YFB_gill_tissue | 0.000613 | yes |
| YFB_cap_tissue | YFB_veil | 0.001625 | yes |
| YFB_gill_tissue | YFB_veil | 0.560709 | no |
| Initials | DIF_gill_tissue | 0.002525 | yes |
| Initials | YFB_stipe_center | 0.935804 | no |
| Initials | YFB_stipe_shell | 0.889360 | no |
| Initials | YFB_stipe_skin | 0.970129 | no |
| Initials | YFB_cap_skin | 0.003765 | yes |
| Initials | YFB_cap_tissue | 0.000613 | yes |
| Initials | YFB_gill_tissue | 0.950483 | no |
| Initials | YFB_veil | 0.437018 | no |
| Initials | Pileal_Stipeal_center | 0.765177 | no |
| Initials | Pileal_Stipeal_shell | 0.034142 | yes |
| Initials | DIF_stipe_center | 0.147418 | no |
| Initials | DIF_stipe_shell | 0.783101 | no |
| Initials | DIF_stipe_skin | 0.616038 | no |
| Initials | DIF_cap_skin | 0.013782 | yes |
| Initials | DIF_cap_tissue | 0.003365 | yes |
| Pileal_Stipeal_center | DIF_gill_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_stipe_center | 0.858362 | no |
| Pileal_Stipeal_center | YFB_stipe_shell | 0.600264 | no |
| Pileal_Stipeal_center | YFB_stipe_skin | 0.716369 | no |
| Pileal_Stipeal_center | YFB_cap_skin | 0.002525 | yes |
| Pileal_Stipeal_center | YFB_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_center | YFB_gill_tissue | 0.711051 | no |
| Pileal_Stipeal_center | YFB_veil | 0.197467 | no |
| Pileal_Stipeal_center | Pileal_Stipeal_shell | 0.010412 | yes |
| Pileal_Stipeal_center | DIF_stipe_center | 0.043121 | yes |
| Pileal_Stipeal_center | DIF_stipe_shell | 0.475154 | no |
| Pileal_Stipeal_center | DIF_stipe_skin | 0.903201 | no |
| Pileal_Stipeal_center | DIF_cap_skin | 0.002525 | yes |
| Pileal_Stipeal_center | DIF_cap_tissue | 0.000613 | yes |
| Pileal_Stipeal_shell | DIF_gill_tissue | 0.341586 | no |
| Pileal_Stipeal_shell | YFB_stipe_center | 0.022892 | yes |
| Pileal_Stipeal_shell | YFB_stipe_shell | 0.081583 | no |
| Pileal_Stipeal_shell | YFB_stipe_skin | 0.047584 | yes |
| Pileal_Stipeal_shell | YFB_cap_skin | 0.676607 | no |
| Pileal_Stipeal_shell | YFB_cap_tissue | 0.032038 | yes |
| Pileal_Stipeal_shell | YFB_gill_tissue | 0.080708 | no |
| Pileal_Stipeal_shell | YFB_veil | 0.412815 | no |
| Pileal_Stipeal_shell | DIF_stipe_center | 0.737450 | no |
| Pileal_Stipeal_shell | DIF_stipe_shell | 0.117172 | no |
| Pileal_Stipeal_shell | DIF_stipe_skin | 0.005671 | yes |
| Pileal_Stipeal_shell | DIF_cap_skin | 0.830937 | no |
| Pileal_Stipeal_shell | DIF_cap_tissue | 0.319878 | no |
| DIF_stipe_center | DIF_gill_tissue | 0.128378 | no |
| DIF_stipe_center | YFB_stipe_center | 0.100411 | no |
| DIF_stipe_center | YFB_stipe_shell | 0.264724 | no |
| DIF_stipe_center | YFB_stipe_skin | 0.172181 | no |
| DIF_stipe_center | YFB_cap_skin | 0.336775 | no |
| DIF_stipe_center | YFB_cap_tissue | 0.007782 | yes |
| DIF_stipe_center | YFB_gill_tissue | 0.250586 | no |
| DIF_stipe_center | YFB_veil | 0.749367 | no |
| DIF_stipe_center | DIF_stipe_shell | 0.356124 | no |
| DIF_stipe_center | DIF_stipe_skin | 0.026955 | yes |
| DIF_stipe_center | DIF_cap_skin | 0.492440 | no |
| DIF_stipe_center | DIF_cap_tissue | 0.110231 | no |
| DIF_stipe_shell | DIF_gill_tissue | 0.005671 | yes |
| DIF_stipe_shell | YFB_stipe_center | 0.683786 | no |
| DIF_stipe_shell | YFB_stipe_shell | 0.929701 | no |
| DIF_stipe_shell | YFB_stipe_skin | 0.828771 | no |
| DIF_stipe_shell | YFB_cap_skin | 0.022892 | yes |
| DIF_stipe_shell | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_shell | YFB_gill_tissue | 0.875069 | no |
| DIF_stipe_shell | YFB_veil | 0.721719 | no |
| DIF_stipe_shell | DIF_stipe_skin | 0.335960 | no |
| DIF_stipe_shell | DIF_cap_skin | 0.051520 | no |
| DIF_stipe_shell | DIF_cap_tissue | 0.007782 | yes |
| DIF_stipe_skin | DIF_gill_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_stipe_center | 0.719785 | no |
| DIF_stipe_skin | YFB_stipe_shell | 0.446922 | no |
| DIF_stipe_skin | YFB_stipe_skin | 0.560654 | no |
| DIF_stipe_skin | YFB_cap_skin | 0.000613 | yes |
| DIF_stipe_skin | YFB_cap_tissue | 0.000613 | yes |
| DIF_stipe_skin | YFB_gill_tissue | 0.566769 | no |
| DIF_stipe_skin | YFB_veil | 0.120521 | no |
| DIF_stipe_skin | DIF_cap_skin | 0.001140 | yes |
| DIF_stipe_skin | DIF_cap_tissue | 0.000613 | yes |
| DIF_cap_skin | DIF_gill_tissue | 0.579955 | no |
| DIF_cap_skin | YFB_stipe_center | 0.006032 | yes |
| DIF_cap_skin | YFB_stipe_shell | 0.030134 | yes |
| DIF_cap_skin | YFB_stipe_skin | 0.015529 | yes |
| DIF_cap_skin | YFB_cap_skin | 0.897792 | no |
| DIF_cap_skin | YFB_cap_tissue | 0.067896 | no |
| DIF_cap_skin | YFB_gill_tissue | 0.028918 | yes |
| DIF_cap_skin | YFB_veil | 0.220687 | no |
| DIF_cap_skin | DIF_cap_tissue | 0.556534 | no |
| DIF_cap_tissue | DIF_gill_tissue | 0.986319 | no |
| DIF_cap_tissue | YFB_stipe_center | 0.000613 | yes |
| DIF_cap_tissue | YFB_stipe_shell | 0.004548 | yes |
| DIF_cap_tissue | YFB_stipe_skin | 0.002084 | yes |
| DIF_cap_tissue | YFB_cap_skin | 0.726228 | no |
| DIF_cap_tissue | YFB_cap_tissue | 0.325869 | no |
| DIF_cap_tissue | YFB_gill_tissue | 0.003765 | yes |
| DIF_cap_tissue | YFB_veil | 0.039390 | yes |
| Type of sequence | Sequence |
|---|---|
| Locus | Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded. |
| Protein | >AgabiH97|089660 MFTRVGAVFIILFPAMLAAASAVPRTTPPQCNGGTIQCCNALYEVTSPIIGVVANPLGILLGPFDGLVGIFCTPV DIIGGGNSCSQQAACCTGTTYGDGIIITRCSPVILDV* |
| Coding | >AgabiH97|089660 ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGCAATGCTCTTTATGAGGTCACTAGCCCCATCATC GGAGTCGTTGCTAATCCTCTCGGCATTCTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTC GATATCATCGGTGGCGGTAATTCTTGCTCTCAGCAAGCAGCTTGTTGCACTGGCACCACTTATGGCGATGGTATT ATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA |
| Transcript | >AgabiH97|089660 ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGCAATGCTCTTTATGAGGTCACTAGCCCCATCATC GGAGTCGTTGCTAATCCTCTCGGCATTCTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTC GATATCATCGGTGGCGGTAATTCTTGCTCTCAGCAAGCAGCTTGTTGCACTGGCACCACTTATGGCGATGGTATT ATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA |
| Gene | >AgabiH97|089660 ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGTAAGTTTACATAGCCATCCTCTGAACACATTCTC AACTACTCTCCAGGCAATGCTCTTTATGAGGTCACTAGCCCCATCATCGGAGTCGTTGCTAATCCTCTCGGCATT CTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTCGATATCATCGGTGGCGGTAATTCTTGG TTCGTACTCTCAAATATCGAGTAAGAAACGTAACTCACGAACGAATTTATAGCTCTCAGCAAGCAGCTTGTTGCA CTGGCACCACTTATGGCGATGGTATTATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA |