Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089660
Gene name
Locationscaffold_6:338716..339156
Strand-
Gene length (bp)440
Transcript length (bp)339
Coding sequence length (bp)339
Protein length (aa) 113

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 1.8E-15 31 108

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 112 2.0E-34
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 9 108 2.0E-18
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 26 106 7.0E-11
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 108 4.0E-10
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 1 112 1.0E-08
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 112 2.0E-34
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 9 108 2.0E-18
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 26 106 7.0E-11
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 108 4.0E-10
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 1 112 1.0E-08
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 1 112 6.0E-07
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 26 112 1.0E-06
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 31 110 8.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 23 0.45

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 49 71 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 82.61 35.22 129.99
Initials Initials knots 52.87 23.98 81.76
Pileal_Stipeal_center Stage I stipe center 63.06 26.76 99.36
Pileal_Stipeal_shell Stage I stipe shell 23.46 8.91 38.02
DIF_stipe_center Stage II stipe center 29.08 11.68 46.47
DIF_stipe_shell Stage II stipe shell 44.70 19.51 69.90
DIF_stipe_skin Stage II stipe skin 68.67 31.87 105.46
DIF_cap_skin Stage II cap skin 20.10 7.32 32.87
DIF_cap_tissue Stage II cap tissue 14.18 4.49 23.86
DIF_gill_tissue Stage II gill tissue 14.41 4.60 24.22
YFB_stipe_center Young fruiting body stipe center 56.07 25.42 86.71
YFB_stipe_shell Young fruiting body stipe shell 47.87 20.88 74.86
YFB_stipe_skin Young fruiting body stipe skin 51.41 23.14 79.67
YFB_cap_skin Young fruiting body cap skin 18.09 6.42 29.77
YFB_cap_tissue Young fruiting body cap tissue 7.89 1.74 14.04
YFB_gill_tissue Young fruiting body gill tissue 50.29 18.03 82.55
YFB_veil Young fruiting body veil 35.80 13.13 58.47

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.395889 no
Casing YFB_stipe_shell 0.191804 no
Casing YFB_stipe_skin 0.261752 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.295810 no
Casing YFB_veil 0.037140 yes
Casing Initials 0.299456 no
Casing Pileal_Stipeal_center 0.613707 no
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.001625 yes
Casing DIF_stipe_shell 0.121416 no
Casing DIF_stipe_skin 0.758030 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.000613 yes
DIF_gill_tissue YFB_stipe_shell 0.004160 yes
DIF_gill_tissue YFB_stipe_skin 0.002525 yes
DIF_gill_tissue YFB_cap_skin 0.752285 no
DIF_gill_tissue YFB_cap_tissue 0.307674 no
DIF_gill_tissue YFB_gill_tissue 0.004928 yes
DIF_gill_tissue YFB_veil 0.038720 yes
YFB_stipe_center YFB_stipe_shell 0.801661 no
YFB_stipe_center YFB_stipe_skin 0.899518 no
YFB_stipe_center YFB_cap_skin 0.003765 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.881271 no
YFB_stipe_center YFB_veil 0.348877 no
YFB_stipe_shell YFB_stipe_skin 0.923455 no
YFB_stipe_shell YFB_cap_skin 0.011041 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.953149 no
YFB_stipe_shell YFB_veil 0.609648 no
YFB_stipe_skin YFB_cap_skin 0.005302 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.978733 no
YFB_stipe_skin YFB_veil 0.476780 no
YFB_cap_skin YFB_cap_tissue 0.112576 no
YFB_cap_skin YFB_gill_tissue 0.014081 yes
YFB_cap_skin YFB_veil 0.131265 no
YFB_cap_tissue YFB_gill_tissue 0.000613 yes
YFB_cap_tissue YFB_veil 0.001625 yes
YFB_gill_tissue YFB_veil 0.560709 no
Initials DIF_gill_tissue 0.002525 yes
Initials YFB_stipe_center 0.935804 no
Initials YFB_stipe_shell 0.889360 no
Initials YFB_stipe_skin 0.970129 no
Initials YFB_cap_skin 0.003765 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.950483 no
Initials YFB_veil 0.437018 no
Initials Pileal_Stipeal_center 0.765177 no
Initials Pileal_Stipeal_shell 0.034142 yes
Initials DIF_stipe_center 0.147418 no
Initials DIF_stipe_shell 0.783101 no
Initials DIF_stipe_skin 0.616038 no
Initials DIF_cap_skin 0.013782 yes
Initials DIF_cap_tissue 0.003365 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.858362 no
Pileal_Stipeal_center YFB_stipe_shell 0.600264 no
Pileal_Stipeal_center YFB_stipe_skin 0.716369 no
Pileal_Stipeal_center YFB_cap_skin 0.002525 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.711051 no
Pileal_Stipeal_center YFB_veil 0.197467 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.010412 yes
Pileal_Stipeal_center DIF_stipe_center 0.043121 yes
Pileal_Stipeal_center DIF_stipe_shell 0.475154 no
Pileal_Stipeal_center DIF_stipe_skin 0.903201 no
Pileal_Stipeal_center DIF_cap_skin 0.002525 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.341586 no
Pileal_Stipeal_shell YFB_stipe_center 0.022892 yes
Pileal_Stipeal_shell YFB_stipe_shell 0.081583 no
Pileal_Stipeal_shell YFB_stipe_skin 0.047584 yes
Pileal_Stipeal_shell YFB_cap_skin 0.676607 no
Pileal_Stipeal_shell YFB_cap_tissue 0.032038 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.080708 no
Pileal_Stipeal_shell YFB_veil 0.412815 no
Pileal_Stipeal_shell DIF_stipe_center 0.737450 no
Pileal_Stipeal_shell DIF_stipe_shell 0.117172 no
Pileal_Stipeal_shell DIF_stipe_skin 0.005671 yes
Pileal_Stipeal_shell DIF_cap_skin 0.830937 no
Pileal_Stipeal_shell DIF_cap_tissue 0.319878 no
DIF_stipe_center DIF_gill_tissue 0.128378 no
DIF_stipe_center YFB_stipe_center 0.100411 no
DIF_stipe_center YFB_stipe_shell 0.264724 no
DIF_stipe_center YFB_stipe_skin 0.172181 no
DIF_stipe_center YFB_cap_skin 0.336775 no
DIF_stipe_center YFB_cap_tissue 0.007782 yes
DIF_stipe_center YFB_gill_tissue 0.250586 no
DIF_stipe_center YFB_veil 0.749367 no
DIF_stipe_center DIF_stipe_shell 0.356124 no
DIF_stipe_center DIF_stipe_skin 0.026955 yes
DIF_stipe_center DIF_cap_skin 0.492440 no
DIF_stipe_center DIF_cap_tissue 0.110231 no
DIF_stipe_shell DIF_gill_tissue 0.005671 yes
DIF_stipe_shell YFB_stipe_center 0.683786 no
DIF_stipe_shell YFB_stipe_shell 0.929701 no
DIF_stipe_shell YFB_stipe_skin 0.828771 no
DIF_stipe_shell YFB_cap_skin 0.022892 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.875069 no
DIF_stipe_shell YFB_veil 0.721719 no
DIF_stipe_shell DIF_stipe_skin 0.335960 no
DIF_stipe_shell DIF_cap_skin 0.051520 no
DIF_stipe_shell DIF_cap_tissue 0.007782 yes
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.719785 no
DIF_stipe_skin YFB_stipe_shell 0.446922 no
DIF_stipe_skin YFB_stipe_skin 0.560654 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.566769 no
DIF_stipe_skin YFB_veil 0.120521 no
DIF_stipe_skin DIF_cap_skin 0.001140 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.579955 no
DIF_cap_skin YFB_stipe_center 0.006032 yes
DIF_cap_skin YFB_stipe_shell 0.030134 yes
DIF_cap_skin YFB_stipe_skin 0.015529 yes
DIF_cap_skin YFB_cap_skin 0.897792 no
DIF_cap_skin YFB_cap_tissue 0.067896 no
DIF_cap_skin YFB_gill_tissue 0.028918 yes
DIF_cap_skin YFB_veil 0.220687 no
DIF_cap_skin DIF_cap_tissue 0.556534 no
DIF_cap_tissue DIF_gill_tissue 0.986319 no
DIF_cap_tissue YFB_stipe_center 0.000613 yes
DIF_cap_tissue YFB_stipe_shell 0.004548 yes
DIF_cap_tissue YFB_stipe_skin 0.002084 yes
DIF_cap_tissue YFB_cap_skin 0.726228 no
DIF_cap_tissue YFB_cap_tissue 0.325869 no
DIF_cap_tissue YFB_gill_tissue 0.003765 yes
DIF_cap_tissue YFB_veil 0.039390 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089660
MFTRVGAVFIILFPAMLAAASAVPRTTPPQCNGGTIQCCNALYEVTSPIIGVVANPLGILLGPFDGLVGIFCTPV
DIIGGGNSCSQQAACCTGTTYGDGIIITRCSPVILDV*
Coding >AgabiH97|089660
ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC
ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGCAATGCTCTTTATGAGGTCACTAGCCCCATCATC
GGAGTCGTTGCTAATCCTCTCGGCATTCTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTC
GATATCATCGGTGGCGGTAATTCTTGCTCTCAGCAAGCAGCTTGTTGCACTGGCACCACTTATGGCGATGGTATT
ATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA
Transcript >AgabiH97|089660
ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC
ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGCAATGCTCTTTATGAGGTCACTAGCCCCATCATC
GGAGTCGTTGCTAATCCTCTCGGCATTCTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTC
GATATCATCGGTGGCGGTAATTCTTGCTCTCAGCAAGCAGCTTGTTGCACTGGCACCACTTATGGCGATGGTATT
ATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA
Gene >AgabiH97|089660
ATGTTCACTCGCGTCGGCGCCGTCTTCATTATTTTGTTCCCCGCCATGCTCGCCGCAGCCAGCGCTGTTCCCCGC
ACTACTCCCCCGCAGTGCAATGGCGGTACCATCCAATGCTGTAAGTTTACATAGCCATCCTCTGAACACATTCTC
AACTACTCTCCAGGCAATGCTCTTTATGAGGTCACTAGCCCCATCATCGGAGTCGTTGCTAATCCTCTCGGCATT
CTCCTGGGTCCCTTCGACGGCCTTGTTGGTATCTTTTGCACCCCCGTCGATATCATCGGTGGCGGTAATTCTTGG
TTCGTACTCTCAAATATCGAGTAAGAAACGTAACTCACGAACGAATTTATAGCTCTCAGCAAGCAGCTTGTTGCA
CTGGCACCACTTATGGCGATGGTATTATCATCACTCGCTGCAGCCCCGTCATCCTCGATGTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail