Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089610
Gene name
Locationscaffold_6:326560..327026
Strand+
Gene length (bp)466
Transcript length (bp)360
Coding sequence length (bp)360
Protein length (aa) 120

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF01185 Hydrophobin Fungal hydrophobin 4.9E-20 40 115

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 119 3.0E-74
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 9 119 8.0E-21
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 117 7.0E-19
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 5 119 7.0E-16
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 28 117 9.0E-14
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|O13300|HYP3_AGABI Hydrophobin-3 OS=Agaricus bisporus GN=abh3 PE=3 SV=1 1 119 3.0E-74
sp|P04158|SC1_SCHCO Fruiting body protein SC1 OS=Schizophyllum commune GN=SC1 PE=2 SV=2 9 119 8.0E-21
sp|P16933|SC3_SCHCO Fruiting body protein SC3 OS=Schizophyllum commune GN=SC3 PE=1 SV=2 1 117 7.0E-19
sp|P49072|HYP1_AGABI Hydrophobin-1 OS=Agaricus bisporus GN=hypA PE=2 SV=1 5 119 7.0E-16
sp|O74300|SC6_SCHCO Hydrophobin-6 OS=Schizophyllum commune GN=SC6 PE=3 SV=1 28 117 9.0E-14
sp|P49073|HYP2_AGABI Hydrophobin-2 OS=Agaricus bisporus GN=hypC PE=3 SV=2 1 119 4.0E-12
sp|O43122|HYP4_AGABI Hydrophobin-B OS=Agaricus bisporus GN=hypB PE=3 SV=1 32 119 1.0E-11
sp|P52748|HYP1_PISTI Hydrophobin-1 OS=Pisolithus tinctorius GN=HYD-1 PE=2 SV=1 20 118 5.0E-10
sp|P16934|SC4_SCHCO Fruiting body protein SC4 OS=Schizophyllum commune GN=SC4 PE=2 SV=1 41 117 2.0E-07
sp|P52749|HYP2_PISTI Hydrophobin-2 (Fragment) OS=Pisolithus tinctorius GN=HYD-2 PE=2 SV=1 41 118 2.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0005199 structural constituent of cell wall Yes
GO:0009277 fungal-type cell wall Yes
GO:0005575 cellular_component No
GO:0003674 molecular_function No
GO:0005618 cell wall No
GO:0030312 external encapsulating structure No
GO:0005198 structural molecule activity No
GO:0110165 cellular anatomical entity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)		 D score
(significance: > 0.45)
Yes 1 - 23 0.5

Transmembrane Domains

Domain # Start End Length
1 5 24 19
2 56 78 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 13377.50 354.63 26400.50
Initials Initials knots 551.15 316.32 785.98
Pileal_Stipeal_center Stage I stipe center 740.12 395.22 1085.00
Pileal_Stipeal_shell Stage I stipe shell 13.88 4.06 23.69
DIF_stipe_center Stage II stipe center 17.93 6.49 29.37
DIF_stipe_shell Stage II stipe shell 24.37 9.56 39.18
DIF_stipe_skin Stage II stipe skin 195.31 88.46 302.16
DIF_cap_skin Stage II cap skin 31.66 13.01 50.31
DIF_cap_tissue Stage II cap tissue 15.58 4.67 26.48
DIF_gill_tissue Stage II gill tissue 5.26 0.97 9.55
YFB_stipe_center Young fruiting body stipe center 18.38 6.04 30.72
YFB_stipe_shell Young fruiting body stipe shell 13.04 4.16 21.93
YFB_stipe_skin Young fruiting body stipe skin 150.17 77.92 222.42
YFB_cap_skin Young fruiting body cap skin 24.52 9.84 39.21
YFB_cap_tissue Young fruiting body cap tissue 4.65 0.72 8.58
YFB_gill_tissue Young fruiting body gill tissue 9.16 2.67 15.65
YFB_veil Young fruiting body veil 4.37 0.56 8.19

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.000613 yes
Casing YFB_stipe_shell 0.000613 yes
Casing YFB_stipe_skin 0.000613 yes
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.000613 yes
Casing Pileal_Stipeal_center 0.000613 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.000613 yes
Casing DIF_stipe_shell 0.000613 yes
Casing DIF_stipe_skin 0.000613 yes
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.014081 yes
DIF_gill_tissue YFB_stipe_shell 0.089130 no
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.002084 yes
DIF_gill_tissue YFB_cap_tissue 0.910343 no
DIF_gill_tissue YFB_gill_tissue 0.369531 no
DIF_gill_tissue YFB_veil 0.858156 no
YFB_stipe_center YFB_stipe_shell 0.582590 no
YFB_stipe_center YFB_stipe_skin 0.000613 yes
YFB_stipe_center YFB_cap_skin 0.638347 no
YFB_stipe_center YFB_cap_tissue 0.010412 yes
YFB_stipe_center YFB_gill_tissue 0.161171 no
YFB_stipe_center YFB_veil 0.010412 yes
YFB_stipe_shell YFB_stipe_skin 0.000613 yes
YFB_stipe_shell YFB_cap_skin 0.179329 no
YFB_stipe_shell YFB_cap_tissue 0.054982 no
YFB_stipe_shell YFB_gill_tissue 0.581604 no
YFB_stipe_shell YFB_veil 0.056170 no
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.004160 yes
YFB_cap_skin YFB_gill_tissue 0.024698 yes
YFB_cap_skin YFB_veil 0.002084 yes
YFB_cap_tissue YFB_gill_tissue 0.246090 no
YFB_cap_tissue YFB_veil 0.957974 no
YFB_gill_tissue YFB_veil 0.225592 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.000613 yes
Initials YFB_stipe_shell 0.000613 yes
Initials YFB_stipe_skin 0.000613 yes
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.421070 no
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.000613 yes
Initials DIF_stipe_shell 0.000613 yes
Initials DIF_stipe_skin 0.000613 yes
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_stipe_center 0.000613 yes
Pileal_Stipeal_center YFB_stipe_shell 0.000613 yes
Pileal_Stipeal_center YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_skin 0.000613 yes
Pileal_Stipeal_center YFB_cap_tissue 0.000613 yes
Pileal_Stipeal_center YFB_gill_tissue 0.000613 yes
Pileal_Stipeal_center YFB_veil 0.000613 yes
Pileal_Stipeal_center Pileal_Stipeal_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_center 0.000613 yes
Pileal_Stipeal_center DIF_stipe_shell 0.000613 yes
Pileal_Stipeal_center DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_skin 0.000613 yes
Pileal_Stipeal_center DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.069013 no
Pileal_Stipeal_shell YFB_stipe_center 0.680762 no
Pileal_Stipeal_shell YFB_stipe_shell 0.947526 no
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.252194 no
Pileal_Stipeal_shell YFB_cap_tissue 0.041824 yes
Pileal_Stipeal_shell YFB_gill_tissue 0.506395 no
Pileal_Stipeal_shell YFB_veil 0.043555 yes
Pileal_Stipeal_shell DIF_stipe_center 0.706052 no
Pileal_Stipeal_shell DIF_stipe_shell 0.255913 no
Pileal_Stipeal_shell DIF_stipe_skin 0.000613 yes
Pileal_Stipeal_shell DIF_cap_skin 0.064892 no
Pileal_Stipeal_shell DIF_cap_tissue 0.896879 no
DIF_stipe_center DIF_gill_tissue 0.017783 yes
DIF_stipe_center YFB_stipe_center 0.977123 no
DIF_stipe_center YFB_stipe_shell 0.607270 no
DIF_stipe_center YFB_stipe_skin 0.000613 yes
DIF_stipe_center YFB_cap_skin 0.585078 no
DIF_stipe_center YFB_cap_tissue 0.012577 yes
DIF_stipe_center YFB_gill_tissue 0.173213 no
DIF_stipe_center YFB_veil 0.011041 yes
DIF_stipe_center DIF_stipe_shell 0.589671 no
DIF_stipe_center DIF_stipe_skin 0.000613 yes
DIF_stipe_center DIF_cap_skin 0.216874 no
DIF_stipe_center DIF_cap_tissue 0.863568 no
DIF_stipe_shell DIF_gill_tissue 0.002084 yes
DIF_stipe_shell YFB_stipe_center 0.638440 no
DIF_stipe_shell YFB_stipe_shell 0.182315 no
DIF_stipe_shell YFB_stipe_skin 0.000613 yes
DIF_stipe_shell YFB_cap_skin 0.992840 no
DIF_stipe_shell YFB_cap_tissue 0.004160 yes
DIF_stipe_shell YFB_gill_tissue 0.023415 yes
DIF_stipe_shell YFB_veil 0.002084 yes
DIF_stipe_shell DIF_stipe_skin 0.000613 yes
DIF_stipe_shell DIF_cap_skin 0.647355 no
DIF_stipe_shell DIF_cap_tissue 0.403475 no
DIF_stipe_skin DIF_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_stipe_center 0.000613 yes
DIF_stipe_skin YFB_stipe_shell 0.000613 yes
DIF_stipe_skin YFB_stipe_skin 0.583245 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.000613 yes
DIF_cap_skin YFB_stipe_center 0.262277 no
DIF_cap_skin YFB_stipe_shell 0.040058 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.667264 no
DIF_cap_skin YFB_cap_tissue 0.001625 yes
DIF_cap_skin YFB_gill_tissue 0.003365 yes
DIF_cap_skin YFB_veil 0.001140 yes
DIF_cap_skin DIF_cap_tissue 0.128665 no
DIF_cap_tissue DIF_gill_tissue 0.038047 yes
DIF_cap_tissue YFB_stipe_center 0.837780 no
DIF_cap_tissue YFB_stipe_shell 0.825803 no
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.400147 no
DIF_cap_tissue YFB_cap_tissue 0.022111 yes
DIF_cap_tissue YFB_gill_tissue 0.351915 no
DIF_cap_tissue YFB_veil 0.024698 yes

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089610
MFARISTILTILFFAMLAAATAVPRTDPPPATGSQCTAVGGDVNCCNSLQEASNPIVGLLAGLLGIVLGPIQGLV
GLTCNPISIIGGGNSCSSQTVCCTGNNFSGGLLVIGCSPINIDL*
Coding >AgabiH97|089610
ATGTTCGCTCGTATCTCTACCATCCTCACCATTTTGTTCTTCGCCATGCTCGCTGCGGCCACTGCTGTCCCCCGC
ACTGACCCGCCCCCGGCTACCGGCAGCCAGTGCACTGCCGTTGGCGGCGATGTCAACTGCTGCAACTCTCTCCAA
GAGGCCAGCAACCCCATCGTCGGACTCCTCGCCGGCCTTCTCGGCATTGTCTTGGGCCCTATCCAAGGCCTCGTT
GGTCTCACTTGCAACCCCATCAGCATCATTGGTGGTGGCAATTCTTGCTCTTCGCAAACGGTCTGCTGCACCGGA
AACAACTTCAGCGGTGGCCTTCTCGTCATTGGCTGCAGCCCTATTAACATTGATCTCTAA
Transcript >AgabiH97|089610
ATGTTCGCTCGTATCTCTACCATCCTCACCATTTTGTTCTTCGCCATGCTCGCTGCGGCCACTGCTGTCCCCCGC
ACTGACCCGCCCCCGGCTACCGGCAGCCAGTGCACTGCCGTTGGCGGCGATGTCAACTGCTGCAACTCTCTCCAA
GAGGCCAGCAACCCCATCGTCGGACTCCTCGCCGGCCTTCTCGGCATTGTCTTGGGCCCTATCCAAGGCCTCGTT
GGTCTCACTTGCAACCCCATCAGCATCATTGGTGGTGGCAATTCTTGCTCTTCGCAAACGGTCTGCTGCACCGGA
AACAACTTCAGCGGTGGCCTTCTCGTCATTGGCTGCAGCCCTATTAACATTGATCTCTAA
Gene >AgabiH97|089610
ATGTTCGCTCGTATCTCTACCATCCTCACCATTTTGTTCTTCGCCATGCTCGCTGCGGCCACTGCTGTCCCCCGC
ACTGACCCGCCCCCGGCTACCGGCAGCCAGTGCACTGCCGTTGGCGGCGATGTCAACTGCTGTAAGTGTATATCT
GACTCATCTCTCGAACATCTTCTCATCTGCTCGCTAGGCAACTCTCTCCAAGAGGCCAGCAACCCCATCGTCGGA
CTCCTCGCCGGCCTTCTCGGCATTGTCTTGGGCCCTATCCAAGGCCTCGTTGGTCTCACTTGCAACCCCATCAGC
ATCATTGGTGGTGGCAATTCTTGGTTCGTACTCTCGATACCGTTGAGTAATAAATATAACTGATGAACGTGTTTA
TAGCTCTTCGCAAACGGTCTGCTGCACCGGAAACAACTTCAGCGGTGGCCTTCTCGTCATTGGCTGCAGCCCTAT
TAACATTGATCTCTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail