Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089560
Gene name
Locationscaffold_6:316032..317950
Strand+
Gene length (bp)1918
Transcript length (bp)1530
Coding sequence length (bp)1530
Protein length (aa) 510

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF00494 SQS_PSY Squalene/phytoene synthase 1.4E-35 59 336

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q92459|FDFT_USTMA Squalene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG9 PE=3 SV=2 1 416 3.0E-149
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 1 395 4.0E-125
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 16 394 6.0E-124
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 441 9.0E-115
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 10 387 2.0E-114
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q92459|FDFT_USTMA Squalene synthase OS=Ustilago maydis (strain 521 / FGSC 9021) GN=ERG9 PE=3 SV=2 1 416 3.0E-149
sp|Q7S4Z6|FDFT_NEUCR Probable squalene synthase OS=Neurospora crassa (strain ATCC 24698 / 74-OR23-1A / CBS 708.71 / DSM 1257 / FGSC 987) GN=erg-6 PE=3 SV=1 1 395 4.0E-125
sp|P36596|FDFT_SCHPO Squalene synthase OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) GN=erg9 PE=1 SV=1 16 394 6.0E-124
sp|O74165|FDFT_CYBJA Squalene synthase OS=Cyberlindnera jadinii GN=ERG9 PE=3 SV=1 1 441 9.0E-115
sp|Q9Y753|FDFT_YARLI Squalene synthase OS=Yarrowia lipolytica (strain CLIB 122 / E 150) GN=SQS1 PE=3 SV=1 10 387 2.0E-114
sp|P78589|FDFT_CANAX Squalene synthase OS=Candida albicans GN=ERG9 PE=3 SV=1 10 435 2.0E-108
sp|P29704|FDFT_YEAST Squalene synthase OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) GN=ERG9 PE=1 SV=2 1 417 5.0E-101
sp|Q752X9|FDFT_ASHGO Squalene synthase OS=Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056) GN=ERG9 PE=3 SV=1 10 393 2.0E-94
sp|P53798|FDFT_MOUSE Squalene synthase OS=Mus musculus GN=Fdft1 PE=1 SV=2 11 395 1.0E-93
sp|Q02769|FDFT_RAT Squalene synthase OS=Rattus norvegicus GN=Fdft1 PE=2 SV=1 11 374 5.0E-93
sp|Q32KR6|FDFT_BOVIN Squalene synthase OS=Bos taurus GN=FDFT1 PE=2 SV=1 11 373 1.0E-91
sp|Q9HGZ6|FDFT_CANGA Squalene synthase OS=Candida glabrata (strain ATCC 2001 / CBS 138 / JCM 3761 / NBRC 0622 / NRRL Y-65) GN=ERG9 PE=3 SV=2 1 399 2.0E-91
sp|Q5R6U3|FDFT_PONAB Squalene synthase OS=Pongo abelii GN=FDFT1 PE=2 SV=1 11 374 7.0E-91
sp|P37268|FDFT_HUMAN Squalene synthase OS=Homo sapiens GN=FDFT1 PE=1 SV=1 11 374 7.0E-91
sp|Q54DR1|FDFT_DICDI Squalene synthase OS=Dictyostelium discoideum GN=fdfT PE=3 SV=1 11 389 3.0E-83
sp|Q9SDW9|BSS_BOTBR Squalene synthase OS=Botryococcus braunii GN=BSS PE=1 SV=1 1 390 1.0E-80
sp|G0Y287|BOSS_BOTBR Botryococcus squalene synthase OS=Botryococcus braunii GN=SSL-2 PE=1 SV=1 7 367 3.0E-80
sp|P53799|FDFT_ARATH Squalene synthase OS=Arabidopsis thaliana GN=SQS1 PE=1 SV=1 52 405 1.0E-73
sp|P53800|FDFT_NICBE Squalene synthase OS=Nicotiana benthamiana PE=2 SV=1 52 374 2.0E-72
sp|G0Y288|BOCS_BOTBR Botryococcene synthase OS=Botryococcus braunii GN=SSL-3 PE=2 SV=1 10 375 1.0E-54
sp|G0Y286|PSDS_BOTBR Presqualene diphosphate synthase OS=Botryococcus braunii GN=SSL-1 PE=1 SV=1 10 349 9.0E-52
[Show less]

GO

GO Term Description Terminal node
GO:0009058 biosynthetic process Yes
GO:0008152 metabolic process No
GO:0008150 biological_process No

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Endoplasmic reticulum Signal peptide|Transmembrane domain 0.2487 0.1618 0.4229 0.4627 0.4483 0.2717 0.7271 0.4619 0.4791 0.0543

SignalP

(None)

Transmembrane Domains

Domain # Start End Length
1 474 496 22

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Expression values

Label Description Expression (RPKM) Confidence interval (low) Confidence interval (high)
Casing Casing mycelium 88.19 51.72 124.66
Initials Initials knots 78.20 46.59 109.81
Pileal_Stipeal_center Stage I stipe center 185.65 104.22 267.08
Pileal_Stipeal_shell Stage I stipe shell 254.82 137.71 371.94
DIF_stipe_center Stage II stipe center 163.84 94.97 232.70
DIF_stipe_shell Stage II stipe shell 108.50 64.63 152.37
DIF_stipe_skin Stage II stipe skin 123.23 73.13 173.34
DIF_cap_skin Stage II cap skin 337.87 180.39 495.35
DIF_cap_tissue Stage II cap tissue 345.72 185.85 505.59
DIF_gill_tissue Stage II gill tissue 288.22 157.44 419.01
YFB_stipe_center Young fruiting body stipe center 163.11 93.47 232.75
YFB_stipe_shell Young fruiting body stipe shell 119.34 66.46 172.21
YFB_stipe_skin Young fruiting body stipe skin 97.18 55.70 138.67
YFB_cap_skin Young fruiting body cap skin 308.30 168.01 448.60
YFB_cap_tissue Young fruiting body cap tissue 437.01 225.46 648.57
YFB_gill_tissue Young fruiting body gill tissue 316.95 172.25 461.65
YFB_veil Young fruiting body veil 307.36 167.88 446.83

Differential expression

Label1 Label2 Q-value Significant difference
Casing DIF_gill_tissue 0.000613 yes
Casing YFB_stipe_center 0.022892 yes
Casing YFB_stipe_shell 0.382679 no
Casing YFB_stipe_skin 0.842674 no
Casing YFB_cap_skin 0.000613 yes
Casing YFB_cap_tissue 0.000613 yes
Casing YFB_gill_tissue 0.000613 yes
Casing YFB_veil 0.000613 yes
Casing Initials 0.789062 no
Casing Pileal_Stipeal_center 0.004548 yes
Casing Pileal_Stipeal_shell 0.000613 yes
Casing DIF_stipe_center 0.022369 yes
Casing DIF_stipe_shell 0.580133 no
Casing DIF_stipe_skin 0.283077 no
Casing DIF_cap_skin 0.000613 yes
Casing DIF_cap_tissue 0.000613 yes
DIF_gill_tissue YFB_stipe_center 0.054375 no
DIF_gill_tissue YFB_stipe_shell 0.001140 yes
DIF_gill_tissue YFB_stipe_skin 0.000613 yes
DIF_gill_tissue YFB_cap_skin 0.906297 no
DIF_gill_tissue YFB_cap_tissue 0.223034 no
DIF_gill_tissue YFB_gill_tissue 0.860021 no
DIF_gill_tissue YFB_veil 0.910967 no
YFB_stipe_center YFB_stipe_shell 0.367738 no
YFB_stipe_center YFB_stipe_skin 0.065276 no
YFB_stipe_center YFB_cap_skin 0.027943 yes
YFB_stipe_center YFB_cap_tissue 0.000613 yes
YFB_stipe_center YFB_gill_tissue 0.020260 yes
YFB_stipe_center YFB_veil 0.026955 yes
YFB_stipe_shell YFB_stipe_skin 0.611869 no
YFB_stipe_shell YFB_cap_skin 0.000613 yes
YFB_stipe_shell YFB_cap_tissue 0.000613 yes
YFB_stipe_shell YFB_gill_tissue 0.000613 yes
YFB_stipe_shell YFB_veil 0.000613 yes
YFB_stipe_skin YFB_cap_skin 0.000613 yes
YFB_stipe_skin YFB_cap_tissue 0.000613 yes
YFB_stipe_skin YFB_gill_tissue 0.000613 yes
YFB_stipe_skin YFB_veil 0.000613 yes
YFB_cap_skin YFB_cap_tissue 0.334080 no
YFB_cap_skin YFB_gill_tissue 0.964337 no
YFB_cap_skin YFB_veil 0.995671 no
YFB_cap_tissue YFB_gill_tissue 0.384897 no
YFB_cap_tissue YFB_veil 0.324693 no
YFB_gill_tissue YFB_veil 0.958814 no
Initials DIF_gill_tissue 0.000613 yes
Initials YFB_stipe_center 0.005671 yes
Initials YFB_stipe_shell 0.169576 no
Initials YFB_stipe_skin 0.557659 no
Initials YFB_cap_skin 0.000613 yes
Initials YFB_cap_tissue 0.000613 yes
Initials YFB_gill_tissue 0.000613 yes
Initials YFB_veil 0.000613 yes
Initials Pileal_Stipeal_center 0.001140 yes
Initials Pileal_Stipeal_shell 0.000613 yes
Initials DIF_stipe_center 0.005671 yes
Initials DIF_stipe_shell 0.289771 no
Initials DIF_stipe_skin 0.108700 no
Initials DIF_cap_skin 0.000613 yes
Initials DIF_cap_tissue 0.000613 yes
Pileal_Stipeal_center DIF_gill_tissue 0.164492 no
Pileal_Stipeal_center YFB_stipe_center 0.779787 no
Pileal_Stipeal_center YFB_stipe_shell 0.156775 no
Pileal_Stipeal_center YFB_stipe_skin 0.014956 yes
Pileal_Stipeal_center YFB_cap_skin 0.098609 no
Pileal_Stipeal_center YFB_cap_tissue 0.001140 yes
Pileal_Stipeal_center YFB_gill_tissue 0.071598 no
Pileal_Stipeal_center YFB_veil 0.094492 no
Pileal_Stipeal_center Pileal_Stipeal_shell 0.366932 no
Pileal_Stipeal_center DIF_stipe_center 0.788689 no
Pileal_Stipeal_center DIF_stipe_shell 0.053358 no
Pileal_Stipeal_center DIF_stipe_skin 0.175547 no
Pileal_Stipeal_center DIF_cap_skin 0.046327 yes
Pileal_Stipeal_center DIF_cap_tissue 0.031557 yes
Pileal_Stipeal_shell DIF_gill_tissue 0.805849 no
Pileal_Stipeal_shell YFB_stipe_center 0.148925 no
Pileal_Stipeal_shell YFB_stipe_shell 0.005302 yes
Pileal_Stipeal_shell YFB_stipe_skin 0.000613 yes
Pileal_Stipeal_shell YFB_cap_skin 0.666104 no
Pileal_Stipeal_shell YFB_cap_tissue 0.084877 no
Pileal_Stipeal_shell YFB_gill_tissue 0.602045 no
Pileal_Stipeal_shell YFB_veil 0.669030 no
Pileal_Stipeal_shell DIF_stipe_center 0.155573 no
Pileal_Stipeal_shell DIF_stipe_shell 0.001625 yes
Pileal_Stipeal_shell DIF_stipe_skin 0.008121 yes
Pileal_Stipeal_shell DIF_cap_skin 0.467202 no
Pileal_Stipeal_shell DIF_cap_tissue 0.413420 no
DIF_stipe_center DIF_gill_tissue 0.057945 no
DIF_stipe_center YFB_stipe_center 0.993078 no
DIF_stipe_center YFB_stipe_shell 0.365313 no
DIF_stipe_center YFB_stipe_skin 0.061662 no
DIF_stipe_center YFB_cap_skin 0.027943 yes
DIF_stipe_center YFB_cap_tissue 0.000613 yes
DIF_stipe_center YFB_gill_tissue 0.019715 yes
DIF_stipe_center YFB_veil 0.026955 yes
DIF_stipe_center DIF_stipe_shell 0.166316 no
DIF_stipe_center DIF_stipe_skin 0.398218 no
DIF_stipe_center DIF_cap_skin 0.016104 yes
DIF_stipe_center DIF_cap_tissue 0.007092 yes
DIF_stipe_shell DIF_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_stipe_center 0.170621 no
DIF_stipe_shell YFB_stipe_shell 0.846721 no
DIF_stipe_shell YFB_stipe_skin 0.810817 no
DIF_stipe_shell YFB_cap_skin 0.000613 yes
DIF_stipe_shell YFB_cap_tissue 0.000613 yes
DIF_stipe_shell YFB_gill_tissue 0.000613 yes
DIF_stipe_shell YFB_veil 0.000613 yes
DIF_stipe_shell DIF_stipe_skin 0.767270 no
DIF_stipe_shell DIF_cap_skin 0.000613 yes
DIF_stipe_shell DIF_cap_tissue 0.000613 yes
DIF_stipe_skin DIF_gill_tissue 0.003365 yes
DIF_stipe_skin YFB_stipe_center 0.405139 no
DIF_stipe_skin YFB_stipe_shell 0.956269 no
DIF_stipe_skin YFB_stipe_skin 0.505897 no
DIF_stipe_skin YFB_cap_skin 0.000613 yes
DIF_stipe_skin YFB_cap_tissue 0.000613 yes
DIF_stipe_skin YFB_gill_tissue 0.000613 yes
DIF_stipe_skin YFB_veil 0.000613 yes
DIF_stipe_skin DIF_cap_skin 0.000613 yes
DIF_stipe_skin DIF_cap_tissue 0.000613 yes
DIF_cap_skin DIF_gill_tissue 0.740521 no
DIF_cap_skin YFB_stipe_center 0.010728 yes
DIF_cap_skin YFB_stipe_shell 0.000613 yes
DIF_cap_skin YFB_stipe_skin 0.000613 yes
DIF_cap_skin YFB_cap_skin 0.868437 no
DIF_cap_skin YFB_cap_tissue 0.535266 no
DIF_cap_skin YFB_gill_tissue 0.913413 no
DIF_cap_skin YFB_veil 0.861261 no
DIF_cap_skin DIF_cap_tissue 0.970213 no
DIF_cap_tissue DIF_gill_tissue 0.690838 no
DIF_cap_tissue YFB_stipe_center 0.008121 yes
DIF_cap_tissue YFB_stipe_shell 0.000613 yes
DIF_cap_tissue YFB_stipe_skin 0.000613 yes
DIF_cap_tissue YFB_cap_skin 0.826989 no
DIF_cap_tissue YFB_cap_tissue 0.581452 no
DIF_cap_tissue YFB_gill_tissue 0.877058 no
DIF_cap_tissue YFB_veil 0.819731 no

Orthologs

Orthofinder run ID1
Orthogroup2884
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|370300
Agaricus bisporus var bisporus H97 AgabiH97|089560 (this protein)
Rhodonia placenta FPRL280 RhoplFPRL280|20_12

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089560
MGATKWLALLLFHPLEFRTLLQFYLYHEQKRDIKALKEHPTSGWDRQSMRRCWDFLDMTSRSFSAVIKELDGDLA
RTICLFYLVLRGLDTIEDDMTIPDKVKQPILRKFHELTVEHGWKFDGCGPNEKDRQLLVEYDTIVEEVNRLDPSF
KEVIIDICHKMENGMADFAHQAATTGKIYIATVAEYDLYCHYVAGLVGEGLSRIFTASGKEAEWLGQQLELSNSM
GLLLQKTNIIRDYREDTDDQRYFWPKEIWGKYGFNEMKEMYAPGASEKAQWVQSGMILDALRHATDALEYLRFLK
NQTIFNFCAIPASMAISTLELCFMNPDMFERNIKIRKATAAQLIMRSTNPRDVGQIFCEYARKIHAKAVPTDPNF
MQISVACGKIEQWCEQNYPSFIQPPNAPGNPPTLDGYDARSRIAEADNKFTSELATRKRMIEIANGDRQIAMQRI
ERFTGGGSNTQASNNGAVSSTTMMFYIAAGIVLIVAVGFGVTFAVIKAAGISLKGSGST*
Coding >AgabiH97|089560
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAGTTCAGGACTCTGCTCCAGTTCTACCTA
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCGGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAA
GTCAAGCAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCT
AATGAGAAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCCTTC
AAAGAGGTCATTATTGACATTTGCCATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACA
GGGAAGATTTACATTGCGACCGTCGCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGG
TTATCCCGAATTTTCACCGCATCAGGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATG
GGACTTCTTCTACAAAAGACCAACATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCC
AAAGAAATTTGGGGCAAGTATGGTTTCAACGAGATGAAAGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAA
TGGGTGCAGAGCGGAATGATCTTGGATGCCCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTGAAG
AACCAGACCATTTTCAACTTTTGTGCCATTCCTGCCTCCATGGCTATCTCCACCCTAGAGCTGTGCTTTATGAAC
CCTGATATGTTCGAGCGGAATATCAAGATTCGCAAGGCTACTGCCGCTCAGCTTATTATGCGATCTACAAATCCT
CGCGATGTTGGTCAGATTTTCTGCGAATACGCTCGTAAAATTCATGCAAAAGCCGTCCCGACCGATCCCAACTTC
ATGCAGATTTCAGTCGCCTGTGGCAAGATTGAACAGTGGTGTGAACAAAACTACCCTTCATTCATCCAACCACCC
AACGCACCAGGTAACCCTCCCACGCTGGACGGATACGATGCTCGTTCACGCATCGCCGAGGCCGACAACAAATTT
ACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGCAATGCAACGAATT
GAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGTCAACGACTATGATGTTC
TATATCGCTGCTGGGATAGTGTTGATCGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTAATCAAGGCTGCTGGT
ATTTCTTTGAAAGGTTCGGGGTCAACATAA
Transcript >AgabiH97|089560
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAGTTCAGGACTCTGCTCCAGTTCTACCTA
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCGGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAA
GTCAAGCAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCT
AATGAGAAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCCTTC
AAAGAGGTCATTATTGACATTTGCCATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACA
GGGAAGATTTACATTGCGACCGTCGCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGG
TTATCCCGAATTTTCACCGCATCAGGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATG
GGACTTCTTCTACAAAAGACCAACATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCC
AAAGAAATTTGGGGCAAGTATGGTTTCAACGAGATGAAAGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAA
TGGGTGCAGAGCGGAATGATCTTGGATGCCCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTGAAG
AACCAGACCATTTTCAACTTTTGTGCCATTCCTGCCTCCATGGCTATCTCCACCCTAGAGCTGTGCTTTATGAAC
CCTGATATGTTCGAGCGGAATATCAAGATTCGCAAGGCTACTGCCGCTCAGCTTATTATGCGATCTACAAATCCT
CGCGATGTTGGTCAGATTTTCTGCGAATACGCTCGTAAAATTCATGCAAAAGCCGTCCCGACCGATCCCAACTTC
ATGCAGATTTCAGTCGCCTGTGGCAAGATTGAACAGTGGTGTGAACAAAACTACCCTTCATTCATCCAACCACCC
AACGCACCAGGTAACCCTCCCACGCTGGACGGATACGATGCTCGTTCACGCATCGCCGAGGCCGACAACAAATTT
ACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGCAATGCAACGAATT
GAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGTCAACGACTATGATGTTC
TATATCGCTGCTGGGATAGTGTTGATCGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTAATCAAGGCTGCTGGT
ATTTCTTTGAAAGGTTCGGGGTCAACATAA
Gene >AgabiH97|089560
ATGGGTGCTACGAAATGGCTCGCTCTTCTCCTCTTCCACCCTCTCGAGTTCAGGACTCTGCTCCAGTTCTACCTA
TACCATGAGCAGAAGCGTGATATCAAGGCCTTGAAGGAGCACCCGACGTCGGGCTGGGACCGGCAGTCGATGCGG
AGATGTTGGGACTTCCTGGACATGACAAGTAGGAGTTTTTCGGCGGTTATTAAGGAACTAGACGGCGACCTGGCT
CGAACAGTAAGTATCCTTGTCCAGTCTTCCTCGGAGGCTTCATATTTCATGCGCCCGTCGATTTGCTCGTACGAG
GAGCCGGGTAGACTTTGTGGCCACGTCGCCCTATAGGAGGGTATTTGTGCAAGAATCATCCATTTGTTGACGTGG
CTATTATTTTAATCGCCGGAATAGAAGCCCCCTATCACGCCGTCTGTGTATGGACCACGCTGACCATGTGTCTAG
ATATGTCTGTTTTACCTCGTTCTTCGAGGTCTGGACACGATCGAAGATGATATGACCATTCCAGACAAAGTCAAG
CAACCCATTTTACGAAAGTTTCACGAATTAACCGTCGAACATGGATGGAAATTCGACGGTTGCGGTCCTAATGAG
AAGGACCGCCAACTCCTTGTCGAATATGACACAATTGTTGAAGAAGTCAACCGCCTTGACCCTTCGTACGTTTTT
GATTCATCGTTTCCCCAAACATTCTTCTCAAATGCCATGCTTTCTAGCTTCAAAGAGGTCATTATTGACATTTGC
CATAAAATGGAAAATGGCATGGCCGACTTTGCCCATCAAGCCGCAACAACAGGGAAGATTTACATTGCGACCGTC
GCTGAATACGACCTATACTGTCACTACGTCGCAGGCCTCGTCGGTGAGGGGTTATCCCGAATTTTCACCGCATCA
GGGAAAGAAGCCGAGTGGCTTGGTCAGCAGCTCGAGTTATCGAACTCCATGGGACTTCTTCTACAAAAGACCAAC
ATCATCCGTGACTACCGAGAGGACACTGACGATCAACGATATTTCTGGCCCAAAGAAATTTGGGGCAAGTATGGT
TTCAACGAGATGAAAGAAATGTACGCACCAGGGGCATCAGAAAAAGCCCAATGGGTGCAGAGCGGAATGATCTTG
GATGCCCTCAGGCACGCGACTGATGCTTTGGAATATCTCCGATTCTTGAAGAACCAGACCATTTTCAACTTTTGT
GCCATTCCTGCCTCCATGGCTATCTCCACCCTAGAGCTGTGCTTTATGAACCCTGATATGTTCGAGCGGAATATC
AAGATTCGCAAGGCTACTGCCGCTCAGGTAGGTCGCTTTGATTTCACTCCAAGCTTCTACTCAAATTGCATACCT
CATTCCAGCTTATTATGCGATCTACAAATCCTCGCGATGTTGGTCAGATTTTCTGCGAATACGCTCGTAAAATTC
ATGCAAAAGCCGTCCCGACCGATCCCAACTTCATGCAGATTTCAGTCGCCTGTGGCAAGGTAAACATACTCTTAT
TCTATGCAGGTTCACGAAATTAATTTTCATTTTCCTGCAGATTGAACAGTGGTGTGAACAAAACTACCCTTCATT
CATCCAACCACCCAACGCACCAGGTAACCCTCCCACGCTGGACGGATACGATGCTCGTTCACGCATCGCCGAGGC
CGACAACAAATTTACATCAGAACTCGCTACCCGTAAACGTATGATCGAAATAGCCAACGGAGATCGTCAAATCGC
AATGCAACGAATTGAGAGATTCACAGGTGGTGGCAGTAATACCCAAGCGTCGAACAATGGTGCAGTGTCGTCAAC
GACTATGATGTTCTATATCGCTGCTGGGATAGTGTTGATCGTCGCTGTCGGTTTCGGTGTAACGTTCGCTGTAAT
CAAGGCTGCTGGTATTTCTTTGAAAGGTTCGGGGTCAACATAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail