Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089510
Gene name
Locationscaffold_6:308084..308600
Strand-
Gene length (bp)516
Transcript length (bp)516
Coding sequence length (bp)516
Protein length (aa) 172

Overview

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

Deeploc

[Help with interpreting the results of Deeploc 2.0]
Localizations Signals Cytoplasm Nucleus Extracellular Cell membrane Mitochondrion Plastid Endoplasmic reticulum Lysosome vacuole Golgi apparatus Peroxisome
Nucleus|Extracellular Nuclear localization signal 0.4457 0.6054 0.6697 0.0476 0.1146 0.0148 0.0976 0.0592 0.0556 0.0246

SignalP

(None)

Transmembrane Domains

(None)

Transcription Factor Class

(None)

CAZymes

(None)

Secondary Metabolism

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Orthologs

Orthofinder run ID1
Orthogroup85
Change Orthofinder run
Species Protein ID
Agaricus bisporus var bisporus H39 AgabiH39|291900
Agaricus bisporus var bisporus H97 AgabiH97|039720
Agaricus bisporus var bisporus H97 AgabiH97|086810
Agaricus bisporus var bisporus H97 AgabiH97|089510 (this protein)
Agaricus bisporus var bisporus H97 AgabiH97|098710
Agaricus bisporus var bisporus H97 AgabiH97|107800
Rhodonia placenta FPRL280 RhoplFPRL280|1232_2
Rhodonia placenta FPRL280 RhoplFPRL280|1518_2

Sequences

Type of sequenceSequence
Locus Download genbank file of locus Download genbank file of locus (reverse complement)
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089510
MKPVVELPPLPAKYFKEEKKGPSYKQQAKIEEGISIEEMLEKFGETEIKLSQKELLGMAPKLREALKDLLSKRRV
PTSNNNIVVDRDQEEEKLDWTYASLNKLGTVQKIQTEAKNKEGNPVKVWEVKEPLTQYLTAVPVEKRERLVFTIE
KEESQSAETMHQEKCFFLNCS*
Coding >AgabiH97|089510
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAAACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTGGGAATGGCGCCGAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCAGTAACAACAATATTGTTGTCGATAGGGATCAAGAAGAAGAAAAGCTTGATTGGACTTACGCTAGTCTT
AACAAGCTAGGGACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGAAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGTCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCGCCGAGACAATGCATCAGGAAAAATGTTTTTTTCTTAATTGTTCTTAA
Transcript >AgabiH97|089510
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAAACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTGGGAATGGCGCCGAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCAGTAACAACAATATTGTTGTCGATAGGGATCAAGAAGAAGAAAAGCTTGATTGGACTTACGCTAGTCTT
AACAAGCTAGGGACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGAAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGTCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCGCCGAGACAATGCATCAGGAAAAATGTTTTTTTCTTAATTGTTCTTAA
Gene >AgabiH97|089510
ATGAAACCGGTAGTAGAATTGCCCCCTCTACCAGCTAAGTACTTCAAAGAAGAAAAGAAAGGACCTAGCTACAAG
CAACAAGCAAAGATTGAGGAGGGTATCAGTATCGAAGAAATGTTAGAGAAATTTGGAGAAACTGAGATAAAGCTC
TCGCAAAAAGAGCTTCTGGGAATGGCGCCGAAGCTTCGCGAAGCGCTTAAAGATTTACTCAGTAAAAGAAGAGTA
CCTACCAGTAACAACAATATTGTTGTCGATAGGGATCAAGAAGAAGAAAAGCTTGATTGGACTTACGCTAGTCTT
AACAAGCTAGGGACGGTACAAAAGATACAAACTGAAGCTAAGAATAAAGAAGGAAACCCAGTGAAAGTTTGGGAA
GTTAAAGAACCTCTGACGCAGTACTTAACAGCGGTACCAGTCGAAAAGCGAGAGAGATTGGTGTTCACCATAGAA
AAAGAGGAGTCTCAGAGCGCCGAGACAATGCATCAGGAAAAATGTTTTTTTCTTAATTGTTCTTAA

© 2023 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail