Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089360
Gene name
Locationscaffold_6:263711..267933
Strand-
Gene length (bp)4222
Transcript length (bp)4161
Coding sequence length (bp)4161
Protein length (aa) 1387

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF20209 DUF6570 Domain of unknown function (DUF6570) 1.1E-34 226 358
PF14214 Helitron_like_N Helitron helicase-like domain at N-terminus 3.3E-30 481 696

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 11 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089360
MAHGRFKDRVPVDLVQQHLLTPLEHALSSNDVCYYHSYIHRESLTTSNDAQSLYVLCNFSFDQLSLYLSRYAIIE
VCNCHGIPYHSTESKTVLYSRLYDHSHCPACDTSATVIRIDYHTPPPVTTTHFPPDPPTERMMSNLIQAFCSEFD
PEKIEEAGCAVCGQLRLKSSMRPLSNIDLDLSPIQQPLTAKQPWSPSTAAEWPIESPILDDTNQLCQNCYDALSI
GKRPHLALANGLWIGVQPPILKELTFVEQLLIARVRHNKCLVRIASSGRAKMSANAIMFQSPTAQVYTVLPPSRE
TLSEVLAYVFIGHAKPTVEDFKKTPMLVRKRKIREALEWLKLNHIDYVDLKISETNLNVYPDEGLPVVVEHCPFD
GSINPLATSLAGEEALDSTDGCRFAVHGLTGHEYSELSLQALKAKALHHLHEGGSVLGVGHGEQPESIFANPQLY
PQMFPCLFPFGYRGLGNSRMEIQISDATHKRWLMNYYDKRFQTDLYFPMIAFNHEQIKRATTNSFLYSKQNKFPD
VARRIALLNPDVLKRVCDGFENTHAFTPQTEQEKECLDLLSDINHTGSNVHGSMTSKQQMRNEIWSLVKARGAPT
WFITFSPADAKHPLSLYYAGDDVTFKLQIKTATERNKLISENPAAAAKCFNFLVNIFIKHVLGMDCENGGLYGKT
SAYYATVEQQGRLSLHLHGLVWIEGALSPQEIRDRLVNYDTVFETQLVRYIESCCQGEFMTGSFQSVVEKFEKPN
VTEHNNVDPTLTLPVPPPNPCTAEPINDALCQCENCCDLRNWKQAFQDTVDNILLNSNMHGCRASVEQLRRLTEA
GVAGHADVSPSIGKGRFLGCMNKYGDCTARFPREIHPETSVDHADGRINLKKREPMMNTFTVVLTYLLRCNTDVT
CILTGTAVKALVAYITDYISKSGLTTHHVFKAAYDVLLKNTGTNDSSSQENNNNSDYARKMILKMVNALAAKMEI
GSPMACMYLLGFPDHYTNITFVPFWWRTYVNEVWHAHLSHQSEHLNQETGNSVLLYRTHQGVSGVSITDDYKYRP
RPYDSVPLYVWIQCARRYKLRRAAAPPPLHRQFLSGHPLKDSHEISYDESRKDNVVPNFVGGSLPQKDQGDPNYF
ACTMLTLFKPWRNPEDLKSFTGQSWTDKSTAFEFPIIYRQTMERFNLAYECLDARDDFSATRKKNKSNDWFPSTE
LHTDINDVFAGDGIVTSNVDDDEYLPPEDPDTNPLVREIDDVLSAIGWSVDSDIPETSPDVVMDDLFDMPDITIK
WKEVVQSRRQEILAARQTQRSSFISSRHVPFREGPENMPKSGPLLLLPPSYFMEDYVPPHVSDKDILSQTIRDFK
LNTEQRRAFTIVANHSTAIAPKQLLMYLGDARDTDL*
Coding >AgabiH97|089360
ATGGCCCATGGTCGTTTTAAGGATAGAGTGCCTGTTGATTTGGTACAACAACACCTCCTTACACCTCTTGAACAC
GCCTTGTCCTCTAACGATGTGTGCTATTACCATTCTTATATCCATCGGGAATCATTGACCACATCGAATGATGCG
CAATCATTATACGTATTGTGCAACTTTTCATTTGATCAACTTTCACTGTATCTCAGTCGGTATGCTATCATTGAA
GTATGCAACTGCCACGGTATCCCATATCATAGTACAGAATCCAAGACAGTGTTATATTCCAGGTTATACGATCAC
AGTCACTGTCCTGCTTGCGACACTTCTGCGACAGTAATTCGCATTGACTATCACACGCCACCGCCTGTTACAACG
ACTCATTTTCCACCGGATCCACCTACTGAACGCATGATGTCGAATTTAATTCAAGCCTTTTGCTCAGAGTTTGAT
CCTGAAAAAATCGAGGAGGCCGGATGTGCAGTGTGTGGGCAGCTGCGATTGAAGTCATCAATGCGTCCTTTGTCG
AACATCGATTTAGACTTATCACCCATACAACAACCGCTCACAGCGAAACAACCTTGGTCACCTTCAACTGCCGCG
GAGTGGCCAATCGAATCGCCCATACTCGACGACACGAATCAGCTGTGTCAAAATTGCTATGATGCTCTGTCAATA
GGAAAGCGTCCCCATCTGGCTTTGGCCAACGGGTTGTGGATTGGTGTCCAACCCCCTATATTGAAGGAATTAACA
TTTGTGGAACAACTTTTAATTGCCCGAGTGAGACATAATAAATGCTTGGTTAGAATAGCGTCGTCCGGAAGGGCA
AAAATGTCCGCGAATGCGATCATGTTCCAAAGCCCAACTGCACAGGTGTATACTGTGTTACCACCCAGCAGAGAG
ACACTGAGTGAAGTACTAGCCTACGTATTCATTGGACATGCTAAACCGACTGTTGAAGATTTCAAGAAAACGCCG
ATGTTGGTGCGGAAACGCAAAATCCGAGAAGCACTTGAATGGTTGAAGTTAAATCACATTGATTATGTGGATCTC
AAAATATCGGAGACCAATTTAAACGTTTATCCGGATGAGGGTCTCCCTGTAGTGGTAGAACATTGTCCTTTCGAT
GGTTCTATTAATCCGCTTGCAACGTCTTTAGCAGGTGAAGAAGCCTTAGACAGTACGGATGGCTGTAGGTTTGCA
GTCCATGGATTAACTGGTCATGAATACTCAGAGCTGTCTCTTCAAGCACTAAAAGCGAAAGCTCTACATCACCTT
CATGAAGGCGGTTCAGTTCTAGGCGTCGGCCATGGTGAACAGCCCGAATCAATCTTCGCAAATCCCCAGCTTTAT
CCGCAAATGTTTCCTTGCTTGTTTCCTTTCGGGTACAGAGGCCTAGGAAATTCAAGAATGGAAATTCAAATATCC
GATGCAACACACAAAAGATGGTTGATGAATTATTACGATAAGCGATTTCAGACTGATTTATACTTCCCTATGATT
GCATTTAACCACGAACAAATCAAACGGGCAACTACTAATAGTTTTTTATACTCAAAACAAAACAAGTTTCCAGAC
GTTGCACGACGAATCGCCCTTCTCAACCCCGACGTTTTAAAACGGGTATGTGATGGTTTTGAAAATACACATGCG
TTTACTCCACAGACTGAACAAGAGAAGGAGTGCTTGGATTTACTGTCAGACATCAATCACACGGGTTCGAATGTC
CATGGATCTATGACGTCCAAACAACAGATGAGAAATGAGATTTGGTCTTTAGTTAAAGCCAGAGGTGCTCCGACG
TGGTTCATAACTTTCTCACCAGCTGATGCGAAACACCCTCTCAGTCTATACTACGCAGGTGACGATGTAACATTT
AAACTGCAAATCAAAACCGCCACTGAACGTAATAAATTGATATCAGAAAACCCGGCTGCTGCTGCAAAATGTTTC
AATTTCCTGGTTAATATTTTTATAAAACACGTCCTAGGCATGGATTGTGAGAACGGAGGCTTATATGGGAAAACC
TCTGCTTATTATGCCACAGTTGAACAACAAGGACGATTGTCTTTACATTTACATGGTCTTGTGTGGATCGAGGGC
GCACTATCACCCCAAGAAATACGTGATCGTCTCGTTAACTACGACACTGTATTTGAGACTCAACTGGTGCGTTAT
ATAGAATCATGTTGTCAAGGAGAATTCATGACCGGCTCGTTTCAATCTGTGGTCGAAAAATTCGAAAAGCCTAAT
GTAACTGAGCATAATAATGTCGATCCTACTCTTACTCTACCTGTTCCGCCTCCGAACCCCTGCACAGCGGAACCA
ATCAATGATGCCCTTTGTCAATGCGAAAATTGCTGTGACCTCCGCAATTGGAAACAGGCCTTTCAAGACACCGTA
GATAACATTTTGCTTAATTCCAACATGCACGGTTGCAGAGCATCCGTTGAACAGTTACGACGTCTAACAGAAGCT
GGCGTTGCAGGCCATGCCGATGTATCACCCTCAATTGGCAAAGGCAGATTTCTAGGATGTATGAACAAATATGGC
GATTGCACGGCGCGATTTCCCAGGGAAATTCATCCTGAAACATCCGTTGACCACGCGGACGGCAGGATCAATTTG
AAAAAACGAGAACCCATGATGAACACTTTTACTGTCGTACTTACTTACTTGCTGAGATGCAACACTGATGTGACT
TGTATATTAACTGGAACAGCGGTAAAAGCGCTGGTTGCATACATTACTGATTACATATCTAAATCAGGGCTAACA
ACTCATCATGTCTTCAAAGCAGCCTACGACGTTCTATTGAAAAACACCGGTACAAACGACTCATCCTCCCAAGAG
AACAACAACAATTCGGACTATGCTCGTAAGATGATTCTGAAGATGGTGAACGCTTTAGCCGCTAAGATGGAAATT
GGCAGCCCCATGGCTTGCATGTACCTGCTTGGCTTTCCGGACCATTACACAAACATCACATTCGTTCCATTCTGG
TGGCGAACATATGTCAACGAAGTATGGCATGCTCACCTTTCACATCAATCTGAGCATCTAAACCAAGAAACTGGA
AATAGTGTTTTGTTGTACCGTACTCACCAAGGCGTATCAGGTGTTAGCATCACGGACGATTATAAATATCGACCT
AGACCATACGATTCTGTGCCCCTGTACGTTTGGATTCAATGTGCCAGAAGATACAAATTGCGACGCGCTGCAGCG
CCGCCCCCGTTACATCGACAATTTTTGAGCGGTCACCCTCTCAAAGATTCTCATGAAATATCTTATGATGAATCA
AGAAAAGACAATGTAGTACCCAATTTTGTAGGCGGTTCTCTGCCTCAAAAAGACCAAGGGGATCCCAATTACTTT
GCATGTACAATGCTTACTTTGTTCAAACCATGGAGAAATCCCGAAGACCTCAAATCTTTTACGGGCCAATCGTGG
ACAGACAAATCAACAGCTTTCGAATTTCCGATAATATACCGGCAGACAATGGAGCGGTTCAATCTGGCGTATGAA
TGCCTAGATGCGCGAGACGATTTTTCTGCGACTCGAAAAAAAAACAAGAGTAATGATTGGTTCCCTTCAACGGAA
TTACACACAGACATAAACGATGTCTTTGCTGGTGACGGTATCGTTACAAGTAACGTCGACGACGACGAATACTTA
CCACCCGAAGACCCTGACACCAATCCCCTGGTGCGTGAAATCGATGATGTATTAAGTGCTATAGGCTGGTCTGTG
GACTCCGATATTCCTGAAACCTCGCCAGACGTTGTCATGGATGATTTATTCGATATGCCAGACATCACCATAAAA
TGGAAGGAGGTGGTTCAATCTCGAAGGCAGGAAATCCTTGCAGCAAGACAGACACAACGATCATCCTTTATCAGC
TCTCGCCACGTTCCATTCCGAGAAGGCCCGGAGAACATGCCAAAATCAGGTCCTCTGTTACTACTACCACCATCT
TATTTCATGGAAGACTACGTCCCGCCCCATGTTTCAGACAAAGACATTCTCTCGCAGACAATCAGAGACTTTAAA
CTAAACACAGAACAAAGACGAGCTTTCACCATTGTAGCCAATCACTCGACGGCGATTGCACCAAAACAATTGTTG
ATGTATTTAGGAGATGCCAGGGACACCGACTTGTAG
Transcript >AgabiH97|089360
ATGGCCCATGGTCGTTTTAAGGATAGAGTGCCTGTTGATTTGGTACAACAACACCTCCTTACACCTCTTGAACAC
GCCTTGTCCTCTAACGATGTGTGCTATTACCATTCTTATATCCATCGGGAATCATTGACCACATCGAATGATGCG
CAATCATTATACGTATTGTGCAACTTTTCATTTGATCAACTTTCACTGTATCTCAGTCGGTATGCTATCATTGAA
GTATGCAACTGCCACGGTATCCCATATCATAGTACAGAATCCAAGACAGTGTTATATTCCAGGTTATACGATCAC
AGTCACTGTCCTGCTTGCGACACTTCTGCGACAGTAATTCGCATTGACTATCACACGCCACCGCCTGTTACAACG
ACTCATTTTCCACCGGATCCACCTACTGAACGCATGATGTCGAATTTAATTCAAGCCTTTTGCTCAGAGTTTGAT
CCTGAAAAAATCGAGGAGGCCGGATGTGCAGTGTGTGGGCAGCTGCGATTGAAGTCATCAATGCGTCCTTTGTCG
AACATCGATTTAGACTTATCACCCATACAACAACCGCTCACAGCGAAACAACCTTGGTCACCTTCAACTGCCGCG
GAGTGGCCAATCGAATCGCCCATACTCGACGACACGAATCAGCTGTGTCAAAATTGCTATGATGCTCTGTCAATA
GGAAAGCGTCCCCATCTGGCTTTGGCCAACGGGTTGTGGATTGGTGTCCAACCCCCTATATTGAAGGAATTAACA
TTTGTGGAACAACTTTTAATTGCCCGAGTGAGACATAATAAATGCTTGGTTAGAATAGCGTCGTCCGGAAGGGCA
AAAATGTCCGCGAATGCGATCATGTTCCAAAGCCCAACTGCACAGGTGTATACTGTGTTACCACCCAGCAGAGAG
ACACTGAGTGAAGTACTAGCCTACGTATTCATTGGACATGCTAAACCGACTGTTGAAGATTTCAAGAAAACGCCG
ATGTTGGTGCGGAAACGCAAAATCCGAGAAGCACTTGAATGGTTGAAGTTAAATCACATTGATTATGTGGATCTC
AAAATATCGGAGACCAATTTAAACGTTTATCCGGATGAGGGTCTCCCTGTAGTGGTAGAACATTGTCCTTTCGAT
GGTTCTATTAATCCGCTTGCAACGTCTTTAGCAGGTGAAGAAGCCTTAGACAGTACGGATGGCTGTAGGTTTGCA
GTCCATGGATTAACTGGTCATGAATACTCAGAGCTGTCTCTTCAAGCACTAAAAGCGAAAGCTCTACATCACCTT
CATGAAGGCGGTTCAGTTCTAGGCGTCGGCCATGGTGAACAGCCCGAATCAATCTTCGCAAATCCCCAGCTTTAT
CCGCAAATGTTTCCTTGCTTGTTTCCTTTCGGGTACAGAGGCCTAGGAAATTCAAGAATGGAAATTCAAATATCC
GATGCAACACACAAAAGATGGTTGATGAATTATTACGATAAGCGATTTCAGACTGATTTATACTTCCCTATGATT
GCATTTAACCACGAACAAATCAAACGGGCAACTACTAATAGTTTTTTATACTCAAAACAAAACAAGTTTCCAGAC
GTTGCACGACGAATCGCCCTTCTCAACCCCGACGTTTTAAAACGGGTATGTGATGGTTTTGAAAATACACATGCG
TTTACTCCACAGACTGAACAAGAGAAGGAGTGCTTGGATTTACTGTCAGACATCAATCACACGGGTTCGAATGTC
CATGGATCTATGACGTCCAAACAACAGATGAGAAATGAGATTTGGTCTTTAGTTAAAGCCAGAGGTGCTCCGACG
TGGTTCATAACTTTCTCACCAGCTGATGCGAAACACCCTCTCAGTCTATACTACGCAGGTGACGATGTAACATTT
AAACTGCAAATCAAAACCGCCACTGAACGTAATAAATTGATATCAGAAAACCCGGCTGCTGCTGCAAAATGTTTC
AATTTCCTGGTTAATATTTTTATAAAACACGTCCTAGGCATGGATTGTGAGAACGGAGGCTTATATGGGAAAACC
TCTGCTTATTATGCCACAGTTGAACAACAAGGACGATTGTCTTTACATTTACATGGTCTTGTGTGGATCGAGGGC
GCACTATCACCCCAAGAAATACGTGATCGTCTCGTTAACTACGACACTGTATTTGAGACTCAACTGGTGCGTTAT
ATAGAATCATGTTGTCAAGGAGAATTCATGACCGGCTCGTTTCAATCTGTGGTCGAAAAATTCGAAAAGCCTAAT
GTAACTGAGCATAATAATGTCGATCCTACTCTTACTCTACCTGTTCCGCCTCCGAACCCCTGCACAGCGGAACCA
ATCAATGATGCCCTTTGTCAATGCGAAAATTGCTGTGACCTCCGCAATTGGAAACAGGCCTTTCAAGACACCGTA
GATAACATTTTGCTTAATTCCAACATGCACGGTTGCAGAGCATCCGTTGAACAGTTACGACGTCTAACAGAAGCT
GGCGTTGCAGGCCATGCCGATGTATCACCCTCAATTGGCAAAGGCAGATTTCTAGGATGTATGAACAAATATGGC
GATTGCACGGCGCGATTTCCCAGGGAAATTCATCCTGAAACATCCGTTGACCACGCGGACGGCAGGATCAATTTG
AAAAAACGAGAACCCATGATGAACACTTTTACTGTCGTACTTACTTACTTGCTGAGATGCAACACTGATGTGACT
TGTATATTAACTGGAACAGCGGTAAAAGCGCTGGTTGCATACATTACTGATTACATATCTAAATCAGGGCTAACA
ACTCATCATGTCTTCAAAGCAGCCTACGACGTTCTATTGAAAAACACCGGTACAAACGACTCATCCTCCCAAGAG
AACAACAACAATTCGGACTATGCTCGTAAGATGATTCTGAAGATGGTGAACGCTTTAGCCGCTAAGATGGAAATT
GGCAGCCCCATGGCTTGCATGTACCTGCTTGGCTTTCCGGACCATTACACAAACATCACATTCGTTCCATTCTGG
TGGCGAACATATGTCAACGAAGTATGGCATGCTCACCTTTCACATCAATCTGAGCATCTAAACCAAGAAACTGGA
AATAGTGTTTTGTTGTACCGTACTCACCAAGGCGTATCAGGTGTTAGCATCACGGACGATTATAAATATCGACCT
AGACCATACGATTCTGTGCCCCTGTACGTTTGGATTCAATGTGCCAGAAGATACAAATTGCGACGCGCTGCAGCG
CCGCCCCCGTTACATCGACAATTTTTGAGCGGTCACCCTCTCAAAGATTCTCATGAAATATCTTATGATGAATCA
AGAAAAGACAATGTAGTACCCAATTTTGTAGGCGGTTCTCTGCCTCAAAAAGACCAAGGGGATCCCAATTACTTT
GCATGTACAATGCTTACTTTGTTCAAACCATGGAGAAATCCCGAAGACCTCAAATCTTTTACGGGCCAATCGTGG
ACAGACAAATCAACAGCTTTCGAATTTCCGATAATATACCGGCAGACAATGGAGCGGTTCAATCTGGCGTATGAA
TGCCTAGATGCGCGAGACGATTTTTCTGCGACTCGAAAAAAAAACAAGAGTAATGATTGGTTCCCTTCAACGGAA
TTACACACAGACATAAACGATGTCTTTGCTGGTGACGGTATCGTTACAAGTAACGTCGACGACGACGAATACTTA
CCACCCGAAGACCCTGACACCAATCCCCTGGTGCGTGAAATCGATGATGTATTAAGTGCTATAGGCTGGTCTGTG
GACTCCGATATTCCTGAAACCTCGCCAGACGTTGTCATGGATGATTTATTCGATATGCCAGACATCACCATAAAA
TGGAAGGAGGTGGTTCAATCTCGAAGGCAGGAAATCCTTGCAGCAAGACAGACACAACGATCATCCTTTATCAGC
TCTCGCCACGTTCCATTCCGAGAAGGCCCGGAGAACATGCCAAAATCAGGTCCTCTGTTACTACTACCACCATCT
TATTTCATGGAAGACTACGTCCCGCCCCATGTTTCAGACAAAGACATTCTCTCGCAGACAATCAGAGACTTTAAA
CTAAACACAGAACAAAGACGAGCTTTCACCATTGTAGCCAATCACTCGACGGCGATTGCACCAAAACAATTGTTG
ATGTATTTAGGAGATGCCAGGGACACCGACTTGTAG
Gene >AgabiH97|089360
ATGGCCCATGGTCGTTTTAAGGATAGAGTGCCTGTTGATTTGGTACAACAACACCTCCTTACACCTCTTGAACAC
GCCTTGTCCTCTAACGATGTGTGCTATTACCATTCTTATATCCATCGGGAATCATTGACCACATCGAATGATGCG
CAATCATTATACGTATTGTGCAACTTTTCATTTGATCAACTTTCACTGTATCTCAGTCGGTATGCTATCATTGAA
GTATGCAACTGCCACGGTATCCCATATCATAGTACAGAATCCAAGACAGTGTTATATTCCAGGTTATACGATCAC
AGTCACTGTCCTGCTTGCGACACTTCTGCGACAGTAATTCGCATTGACTATCACACGCCACCGCCTGTTACAACG
ACTCATTTTCCACCGGATCCACCTACTGAACGCATGATGTCGAATTTAATTCAAGCCTTTTGCTCAGAGTTTGAT
CCTGAAAAAATCGAGGAGGCCGGATGTGCAGTGTGTGGGCAGCTGCGATTGAAGTCATCAATGCGTCCTTTGTCG
AACATCGATTTAGACTTATCACCCATACAACAACCGCTCACAGCGAAACAACCTTGGTCACCTTCAACTGCCGCG
GAGTGGCCAATCGAATCGCCCATACTCGACGACACGAATCAGCTGTGTCAAAATTGCTATGATGCTCTGTCAATA
GGAAAGCGTCCCCATCTGGCTTTGGCCAACGGGTTGTGGATTGGTGTCCAACCCCCTATATTGAAGGAATTAACA
TTTGTGGAACAACTTTTAATTGCCCGAGTGAGACATAATAAATGCTTGGTTAGAATAGCGTCGTCCGGAAGGGCA
AAAATGTCCGCGAATGCGATCATGTTCCAAAGCCCAACTGCACAGGTGTATACTGTGTTACCACCCAGCAGAGAG
ACACTGAGTGAAGTACTAGCCTACGTATTCATTGGACATGCTAAACCGACTGTTGAAGATTTCAAGAAAACGCCG
ATGTTGGTGCGGAAACGCAAAATCCGAGAAGCACTTGAATGGTTGAAGTTAAATCACATTGATTATGTGGATCTC
AAAATATCGGAGACCAATTTAAACGTTTATCCGGATGAGGGTCTCCCTGTAGTGGTAGAACATTGTCCTTTCGAT
GGTTCTATTAATCCGCTTGCAACGTCTTTAGCAGGTGAAGAAGCCTTAGACAGTACGGATGGCTGTAGGTTTGCA
GTCCATGGATTAACTGGTCATGAATACTCAGAGCTGTCTCTTCAAGCACTAAAAGCGAAAGCTCTACATCACCTT
CATGAAGGCGGTTCAGTTCTAGGCGTCGGCCATGGTGAACAGCCCGAATCAATCTTCGCAAATCCCCAGCTTTAT
CCGCAAATGTTTCCTTGCTTGTTTCCTTTCGGGTACAGAGGCCTAGGAAATTCAAGAATGGAAATTCAAATATCC
GATGCAACACACAAAAGATGGTTGATGAATTATTACGATAAGCGATTTCAGACTGATTTATACTTCCCTATGATT
GCATTTAACCACGAACAAATCAAACGGGCAACTACTAATAGTTTTTTATACTCAAAACAAAACAAGTTTCCAGAC
GTTGCACGACGAATCGCCCTTCTCAACCCCGACGTTTTAAAACGGGTATGTGATGGTTTTGAAAATACACATGCG
TTTACTCCACAGACTGAACAAGAGAAGGAGTGCTTGGATTTACTGTCAGACATCAATCACACGGGTTCGAATGTC
CATGGATCTATGACGTCCAAACAACAGATGAGAAATGAGATTTGGTCTTTAGTTAAAGCCAGAGGTGCTCCGACG
TGGTTCATAACTTTCTCACCAGCTGATGCGAAACACCCTCTCAGTCTATACTACGCAGGTGACGATGTAACATTT
AAACTGCAAATCAAAACCGCCACTGAACGTAATAAATTGATATCAGAAAACCCGGCTGCTGCTGCAAAATGTTTC
AATTTCCTGGTTAATATTTTTATAAAACACGTCCTAGGCATGGATTGTGAGAACGGAGGCTTATATGGGAAAACC
TCTGCTTATTATGCCACAGTTGAACAACAAGGACGATTGTCTTTACATTTACATGGTCTTGTGTGGATCGAGGGC
GCACTATCACCCCAAGAAATACGTGATCGTCTCGTTAACTACGACACTGTATTTGAGACTCAACTGGTGCGTTAT
ATAGAATCATGTTGTCAAGGAGAATTCATGACCGGCTCGTTTCAATCTGTGGTCGAAAAATTCGAAAAGCCTAAT
GTAACTGAGCATAATAATGTCGATCCTACTCTTACTCTACCTGTTCCGCCTCCGAACCCCTGCACAGCGGAACCA
ATCAATGATGCCCTTTGTCAATGCGAAAATTGCTGTGACCTCCGCAATTGGAAACAGGCCTTTCAAGACACCGTA
GATAACATTTTGCTTAATTCCAACATGCACGGTTGCAGAGCATCCGTTGAACAGTTACGACGTCTAACAGAAGCT
GGCGTTGCAGGCCATGCCGATGTATCACCCTCAATTGGCAAAGGCAGATTTCTAGGATGTATGAACAAATATGGC
GATTGCACGGCGCGATTTCCCAGGGAAATTCATCCTGAAACATCCGTTGACCACGCGGACGGCAGGATCAATTTG
AAAAAACGAGAACCCATGATGAACACTTTTACTGTCGTACTTACTTACTTGCTGAGATGCAACACTGATGTGACT
TGTATATTAACTGGAACAGCGGTAAAAGCGCTGGTTGCATACATTACTGATTACATATCTAAATCAGGGCTAACA
ACTCATCATGTCTTCAAAGCAGCCTACGACGTTCTATTGAAAAACACCGGTACAAACGACTCATCCTCCCAAGAG
AACAACAACAATTCGGACTATGCTCGTAAGATGATTCTGAAGATGGTGAACGCTTTAGCCGCTAAGATGGAAATT
GGCAGCCCCATGGCTTGCATGTACCTGCTTGGCTTTCCGGACCATTACACAAACATCACATTCGTTCCATTCTGG
TGGCGAACATATGTCAACGAAGTATGGCATGCTCACCTTTCACATCAATCTGAGCATCTAAACCAAGAAACTGGA
AATAGTGTTTTGTTGTACCGTACTCACCAAGGCGTATCAGGTGTTAGCATCACGGACGATTATAAATATCGACCT
AGACCATACGATTCTGTGCCCCTGTACGTTTGGATTCAATGTGCCAGAAGATACAAATTGCGACGCGCTGCAGCG
CCGCCCCCGTTACATCGACAATTTTTGAGCGGTCACCCTCTCAAAGATTCTCATGAAATATCTTATGATGAATCA
AGAAAAGACAATGTAGTACCCAATTTTGTAGGCGGTTCTCTGCCTCAAAAAGACCAAGGGGATCCCAATTACTTT
GCATGTACAATGCTTACTTTGTTCAAACCATGGAGAAATCCCGAAGACCTCAAATCTTTTACGGGCCAATCGTGG
ACAGACAAATCAACAGCTTTCGAATTTCCGATAATATACCGGCAGACAATGGAGCGGTTCAATCTGGCGTATGAA
TGCCTAGATGCGCGAGACGATTTTTCTGCGACTCGAAAAAAAAACAAGAGTAATGATTGGTTCCCTTCAACGGAA
TTACACACAGACATAAACGATGTCTTTGCTGGTGACGGTATCGTTACAAGTAACGTCGACGACGACGAATACTTA
CCACCCGAAGACCCTGACACCAATCCCCTGGTGCGTGAAATCGATGATGTATTAAGTGCTATAGGCTGGTCTGTG
GACTCCGATATTCCTGAAACCTCGCCAGACGTTGTCATGGATGATTTATTCGATATGCCAGACATCACCATAAAA
TGGAAGGAGGTGGTTCAATCTCGAAGGCAGGAAATCCTTGCAGCAAGACAGACACAACGATCATCCTTTATCAGC
TCTCGCCACGTTCCATTCCGAGAAGGCCCGGAGAACATGCCAAAATCAGGTCCTCTGTTACTACTACCACCATCT
TATTTCATGGAAGACTACGTCCCGCCCCATGTTTCAGACAAAGACATTCTCTCGCAGACAATCAGAGACTTTAAA
CTAAACACAGAACAAAGACGAGCTTTCACCATTGTAGCCAATCACTCGACGGCGATTGCACCAAAACAATTGTTG
ATGTATTTAGGAGGTATGGGAGGCACAGGTAAAACGCAAGTTCTTCGGGCATTAACAGCGTTCTTCACTTCCAGA
TGCCAGGGACACCGACTTGTAG

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail