Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|089240
Gene name
Locationscaffold_6:225833..227268
Strand+
Gene length (bp)1435
Transcript length (bp)969
Coding sequence length (bp)969
Protein length (aa) 323

Your browser does not support drawing a protein figure.

PFAM Domains

PFAM Domain ID Short name Long name E-value Start End
PF13489 Methyltransf_23 Methyltransferase domain 2.6E-16 56 172
PF13847 Methyltransf_31 Methyltransferase domain 2.9E-11 58 159
PF08241 Methyltransf_11 Methyltransferase domain 5.5E-11 63 155
PF13649 Methyltransf_25 Methyltransferase domain 1.4E-10 62 151
PF08242 Methyltransf_12 Methyltransferase domain 2.0E-10 63 153
PF06325 PrmA Ribosomal protein L11 methyltransferase (PrmA) 6.3E-06 58 155

Swissprot hits

[Show all]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 47 156 7.0E-11
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 47 156 8.0E-11
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 62 151 1.0E-09
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 48 156 2.0E-09
sp|Q7VKW2|UBIG_HAEDU Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiG PE=3 SV=1 62 156 6.0E-09
[Show all]
[Show less]
Swissprot ID Swissprot Description Start End E-value
sp|Q4FVG3|UBIG_PSYA2 Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter arcticus (strain DSM 17307 / 273-4) GN=ubiG PE=3 SV=2 47 156 7.0E-11
sp|Q1QEI9|UBIG_PSYCK Ubiquinone biosynthesis O-methyltransferase OS=Psychrobacter cryohalolentis (strain K5) GN=ubiG PE=3 SV=2 47 156 8.0E-11
sp|Q5QZ53|UBIG_IDILO Ubiquinone biosynthesis O-methyltransferase OS=Idiomarina loihiensis (strain ATCC BAA-735 / DSM 15497 / L2-TR) GN=ubiG PE=3 SV=1 62 151 1.0E-09
sp|Q2L2T5|UBIG_BORA1 Ubiquinone biosynthesis O-methyltransferase OS=Bordetella avium (strain 197N) GN=ubiG PE=3 SV=1 48 156 2.0E-09
sp|Q7VKW2|UBIG_HAEDU Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus ducreyi (strain 35000HP / ATCC 700724) GN=ubiG PE=3 SV=1 62 156 6.0E-09
sp|A3MZ07|UBIG_ACTP2 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 5b (strain L20) GN=ubiG PE=3 SV=1 50 156 7.0E-09
sp|B1Y2L3|UBIG_LEPCP Ubiquinone biosynthesis O-methyltransferase OS=Leptothrix cholodnii (strain ATCC 51168 / LMG 8142 / SP-6) GN=ubiG PE=3 SV=1 50 156 1.0E-08
sp|Q7WGT9|UBIG_BORBR Ubiquinone biosynthesis O-methyltransferase OS=Bordetella bronchiseptica (strain ATCC BAA-588 / NCTC 13252 / RB50) GN=ubiG PE=3 SV=2 50 156 1.0E-08
sp|B3H0C8|UBIG_ACTP7 Ubiquinone biosynthesis O-methyltransferase OS=Actinobacillus pleuropneumoniae serotype 7 (strain AP76) GN=ubiG PE=3 SV=1 50 156 1.0E-08
sp|Q7VZG7|UBIG_BORPE Ubiquinone biosynthesis O-methyltransferase OS=Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251) GN=ubiG PE=3 SV=1 50 156 4.0E-08
sp|Q9CMI6|UBIG_PASMU Ubiquinone biosynthesis O-methyltransferase OS=Pasteurella multocida (strain Pm70) GN=ubiG PE=3 SV=1 62 156 4.0E-08
sp|Q7N2M5|UBIG_PHOLL Ubiquinone biosynthesis O-methyltransferase OS=Photorhabdus luminescens subsp. laumondii (strain TT01) GN=ubiG PE=3 SV=1 62 156 6.0E-08
sp|A1TSA0|UBIG_ACIAC Ubiquinone biosynthesis O-methyltransferase OS=Acidovorax citrulli (strain AAC00-1) GN=ubiG PE=3 SV=1 62 156 7.0E-08
sp|Q6FFY1|UBIG_ACIAD Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baylyi (strain ATCC 33305 / BD413 / ADP1) GN=ubiG PE=3 SV=1 50 156 1.0E-07
sp|Q7NZ91|UBIG_CHRVO Ubiquinone biosynthesis O-methyltransferase OS=Chromobacterium violaceum (strain ATCC 12472 / DSM 30191 / JCM 1249 / NBRC 12614 / NCIMB 9131 / NCTC 9757) GN=ubiG PE=3 SV=1 62 156 1.0E-07
sp|Q2Y6Z3|UBIG_NITMU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosospira multiformis (strain ATCC 25196 / NCIMB 11849) GN=ubiG PE=3 SV=1 55 156 2.0E-07
sp|Q7W5Z6|UBIG_BORPA Ubiquinone biosynthesis O-methyltransferase OS=Bordetella parapertussis (strain 12822 / ATCC BAA-587 / NCTC 13253) GN=ubiG PE=3 SV=2 50 149 2.0E-07
sp|Q0AA73|UBIG_ALKEH Ubiquinone biosynthesis O-methyltransferase OS=Alkalilimnicola ehrlichii (strain ATCC BAA-1101 / DSM 17681 / MLHE-1) GN=ubiG PE=3 SV=1 50 156 2.0E-07
sp|B0U3W1|UBIG_XYLFM Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M12) GN=ubiG PE=3 SV=1 62 156 2.0E-07
sp|A4VLX7|UBIG_PSEU5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas stutzeri (strain A1501) GN=ubiG PE=3 SV=1 62 151 2.0E-07
sp|Q21UL3|UBIG_RHOFT Ubiquinone biosynthesis O-methyltransferase OS=Rhodoferax ferrireducens (strain ATCC BAA-621 / DSM 15236 / T118) GN=ubiG PE=3 SV=1 28 156 2.0E-07
sp|C3K6J1|UBIG_PSEFS Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain SBW25) GN=ubiG PE=3 SV=1 62 151 2.0E-07
sp|B4EZ30|UBIG_PROMH Ubiquinone biosynthesis O-methyltransferase OS=Proteus mirabilis (strain HI4320) GN=ubiG PE=3 SV=1 62 156 2.0E-07
sp|Q87BG5|UBIG_XYLFT Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain Temecula1 / ATCC 700964) GN=ubiG PE=3 SV=1 62 156 3.0E-07
sp|B2I705|UBIG_XYLF2 Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain M23) GN=ubiG PE=3 SV=1 62 156 3.0E-07
sp|Q9PAM5|UBIG_XYLFA Ubiquinone biosynthesis O-methyltransferase OS=Xylella fastidiosa (strain 9a5c) GN=ubiG PE=3 SV=1 62 156 3.0E-07
sp|Q8PK00|UBIG_XANAC Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas axonopodis pv. citri (strain 306) GN=ubiG PE=3 SV=1 62 156 3.0E-07
sp|Q3BSF8|UBIG_XANC5 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. vesicatoria (strain 85-10) GN=ubiG PE=3 SV=1 62 156 3.0E-07
sp|B0UUV6|UBIG_HISS2 Ubiquinone biosynthesis O-methyltransferase OS=Histophilus somni (strain 2336) GN=ubiG PE=3 SV=1 44 156 3.0E-07
sp|Q0I3Y4|UBIG_HAES1 Ubiquinone biosynthesis O-methyltransferase OS=Haemophilus somnus (strain 129Pt) GN=ubiG PE=3 SV=1 44 156 3.0E-07
sp|A9L2Y4|UBIG_SHEB9 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS195) GN=ubiG PE=3 SV=1 22 156 4.0E-07
sp|A6WNN7|UBIG_SHEB8 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS185) GN=ubiG PE=3 SV=1 22 156 4.0E-07
sp|A3D499|UBIG_SHEB5 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS155 / ATCC BAA-1091) GN=ubiG PE=3 SV=1 22 156 4.0E-07
sp|B8EA88|UBIG_SHEB2 Ubiquinone biosynthesis O-methyltransferase OS=Shewanella baltica (strain OS223) GN=ubiG PE=3 SV=1 22 156 4.0E-07
sp|Q3ILA5|UBIG_PSEHT Ubiquinone biosynthesis O-methyltransferase OS=Pseudoalteromonas haloplanktis (strain TAC 125) GN=ubiG PE=3 SV=1 23 149 4.0E-07
sp|A9M0C4|UBIG_NEIM0 Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup C (strain 053442) GN=ubiG PE=3 SV=1 62 156 4.0E-07
sp|Q8P8H2|UBIG_XANCP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain ATCC 33913 / DSM 3586 / NCPPB 528 / LMG 568 / P 25) GN=ubiG PE=3 SV=1 62 156 4.0E-07
sp|B0RS27|UBIG_XANCB Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain B100) GN=ubiG PE=3 SV=1 62 156 4.0E-07
sp|Q4UVL4|UBIG_XANC8 Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas campestris pv. campestris (strain 8004) GN=ubiG PE=3 SV=1 62 156 4.0E-07
sp|B5BCS0|UBIG_SALPK Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain AKU_12601) GN=ubiG PE=3 SV=1 62 151 5.0E-07
sp|Q5PCY1|UBIG_SALPA Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi A (strain ATCC 9150 / SARB42) GN=ubiG PE=3 SV=1 62 151 5.0E-07
sp|Q9JXI7|UBIG_NEIMB Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup B (strain MC58) GN=ubiG PE=3 SV=2 62 156 6.0E-07
sp|B0TT38|UBIG_SHEHH Ubiquinone biosynthesis O-methyltransferase OS=Shewanella halifaxensis (strain HAW-EB4) GN=ubiG PE=3 SV=1 62 156 6.0E-07
sp|A8H499|UBIG_SHEPA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella pealeana (strain ATCC 700345 / ANG-SQ1) GN=ubiG PE=3 SV=1 50 156 6.0E-07
sp|A1K8Q1|UBIG_AZOSB Ubiquinone biosynthesis O-methyltransferase OS=Azoarcus sp. (strain BH72) GN=ubiG PE=3 SV=1 62 156 7.0E-07
sp|A9MJY3|UBIG_SALAR Ubiquinone biosynthesis O-methyltransferase OS=Salmonella arizonae (strain ATCC BAA-731 / CDC346-86 / RSK2980) GN=ubiG PE=3 SV=1 62 151 7.0E-07
sp|Q4K8M4|UBIG_PSEF5 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf-5 / ATCC BAA-477) GN=ubiG PE=3 SV=1 62 151 9.0E-07
sp|A6V2Q4|UBIG_PSEA7 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain PA7) GN=ubiG PE=3 SV=1 62 156 9.0E-07
sp|A1U3K1|UBIG_MARHV Ubiquinone biosynthesis O-methyltransferase OS=Marinobacter hydrocarbonoclasticus (strain ATCC 700491 / DSM 11845 / VT8) GN=ubiG PE=3 SV=1 63 156 9.0E-07
sp|Q3K8T6|UBIG_PSEPF Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas fluorescens (strain Pf0-1) GN=ubiG PE=3 SV=1 62 151 9.0E-07
sp|Q820B5|UBIG_COXBU Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 493 / Nine Mile phase I) GN=ubiG PE=3 SV=1 37 156 1.0E-06
sp|A9NBI0|UBIG_COXBR Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain RSA 331 / Henzerling II) GN=ubiG PE=3 SV=1 37 156 1.0E-06
sp|B6J1W2|UBIG_COXB2 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuG_Q212) GN=ubiG PE=3 SV=1 37 156 1.0E-06
sp|B6J5Y2|UBIG_COXB1 Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain CbuK_Q154) GN=ubiG PE=3 SV=1 37 156 1.0E-06
sp|A9KGL7|UBIG_COXBN Ubiquinone biosynthesis O-methyltransferase OS=Coxiella burnetii (strain Dugway 5J108-111) GN=ubiG PE=3 SV=1 37 156 1.0E-06
sp|Q02PX7|UBIG_PSEAB Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain UCBPP-PA14) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|Q9JWE6|UBIG_NEIMA Ubiquinone biosynthesis O-methyltransferase OS=Neisseria meningitidis serogroup A / serotype 4A (strain Z2491) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|Q9HZ63|UBIG_PSEAE Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|B7V9J5|UBIG_PSEA8 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas aeruginosa (strain LESB58) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|Q1IDA6|UBIG_PSEE4 Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas entomophila (strain L48) GN=ubiG PE=3 SV=1 62 151 1.0E-06
sp|C1DRQ3|UBIG_AZOVD Ubiquinone biosynthesis O-methyltransferase OS=Azotobacter vinelandii (strain DJ / ATCC BAA-1303) GN=ubiG PE=3 SV=1 38 151 1.0E-06
sp|Q5GZB5|UBIG_XANOR Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain KACC10331 / KXO85) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|B2SHS9|UBIG_XANOP Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain PXO99A) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|Q2P2C4|UBIG_XANOM Ubiquinone biosynthesis O-methyltransferase OS=Xanthomonas oryzae pv. oryzae (strain MAFF 311018) GN=ubiG PE=3 SV=1 62 156 1.0E-06
sp|B0V5X4|UBIG_ACIBY Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AYE) GN=ubiG PE=3 SV=1 62 156 2.0E-06
sp|B7IBN2|UBIG_ACIB5 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB0057) GN=ubiG PE=3 SV=1 62 156 2.0E-06
sp|B7H2Y9|UBIG_ACIB3 Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain AB307-0294) GN=ubiG PE=3 SV=1 62 156 2.0E-06
sp|B0VMN8|UBIG_ACIBS Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain SDF) GN=ubiG PE=3 SV=1 62 156 2.0E-06
sp|B2I023|UBIG_ACIBC Ubiquinone biosynthesis O-methyltransferase OS=Acinetobacter baumannii (strain ACICU) GN=ubiG PE=3 SV=1 62 156 2.0E-06
sp|Q2SE61|UBIG_HAHCH Ubiquinone biosynthesis O-methyltransferase OS=Hahella chejuensis (strain KCTC 2396) GN=ubiG PE=3 SV=1 56 156 2.0E-06
sp|B2VIL6|UBIG_ERWT9 Ubiquinone biosynthesis O-methyltransferase OS=Erwinia tasmaniensis (strain DSM 17950 / Et1/99) GN=ubiG PE=3 SV=1 50 151 2.0E-06
sp|A0KWN3|UBIG_SHESA Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain ANA-3) GN=ubiG PE=3 SV=1 50 156 2.0E-06
sp|B7NN47|UBIG_ECO7I Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O7:K1 (strain IAI39 / ExPEC) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|Q8Z560|UBIG_SALTI Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhi GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|C0Q093|UBIG_SALPC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella paratyphi C (strain RKS4594) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B5RCA1|UBIG_SALG2 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella gallinarum (strain 287/91 / NCTC 13346) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B5R249|UBIG_SALEP Ubiquinone biosynthesis O-methyltransferase OS=Salmonella enteritidis PT4 (strain P125109) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|Q57M77|UBIG_SALCH Ubiquinone biosynthesis O-methyltransferase OS=Salmonella choleraesuis (strain SC-B67) GN=ubiG PE=3 SV=2 62 151 2.0E-06
sp|P37431|UBIG_SALTY Ubiquinone biosynthesis O-methyltransferase OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) GN=ubiG PE=3 SV=2 62 151 2.0E-06
sp|B4TPG0|UBIG_SALSV Ubiquinone biosynthesis O-methyltransferase OS=Salmonella schwarzengrund (strain CVM19633) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B4SYU8|UBIG_SALNS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella newport (strain SL254) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B4TBE3|UBIG_SALHS Ubiquinone biosynthesis O-methyltransferase OS=Salmonella heidelberg (strain SL476) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B5FNR7|UBIG_SALDC Ubiquinone biosynthesis O-methyltransferase OS=Salmonella dublin (strain CT_02021853) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|B5EYW1|UBIG_SALA4 Ubiquinone biosynthesis O-methyltransferase OS=Salmonella agona (strain SL483) GN=ubiG PE=3 SV=1 62 151 2.0E-06
sp|Q31GD8|UBIG_THICR Ubiquinone biosynthesis O-methyltransferase OS=Thiomicrospira crunogena (strain XCL-2) GN=ubiG PE=3 SV=1 58 156 3.0E-06
sp|Q885T9|UBIG_PSESM Ubiquinone biosynthesis O-methyltransferase OS=Pseudomonas syringae pv. tomato (strain DC3000) GN=ubiG PE=3 SV=2 62 151 3.0E-06
sp|B7UFP4|UBIG_ECO27 Ubiquinone biosynthesis O-methyltransferase OS=Escherichia coli O127:H6 (strain E2348/69 / EPEC) GN=ubiG PE=3 SV=1 62 151 3.0E-06
sp|Q0HIX5|UBIG_SHESM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain MR-4) GN=ubiG PE=3 SV=1 22 156 3.0E-06
sp|Q8EEG9|UBIG_SHEON Ubiquinone biosynthesis O-methyltransferase OS=Shewanella oneidensis (strain MR-1) GN=ubiG PE=3 SV=1 22 156 4.0E-06
sp|A4WCN5|UBIG_ENT38 Ubiquinone biosynthesis O-methyltransferase OS=Enterobacter sp. (strain 638) GN=ubiG PE=3 SV=1 62 151 4.0E-06
sp|Q47GP8|UBIG_DECAR Ubiquinone biosynthesis O-methyltransferase OS=Dechloromonas aromatica (strain RCB) GN=ubiG PE=3 SV=1 62 156 4.0E-06
sp|A1RJD1|UBIG_SHESW Ubiquinone biosynthesis O-methyltransferase OS=Shewanella sp. (strain W3-18-1) GN=ubiG PE=3 SV=1 22 156 5.0E-06
sp|A4Y759|UBIG_SHEPC Ubiquinone biosynthesis O-methyltransferase OS=Shewanella putrefaciens (strain CN-32 / ATCC BAA-453) GN=ubiG PE=3 SV=1 22 156 6.0E-06
sp|A1JLA0|UBIG_YERE8 Ubiquinone biosynthesis O-methyltransferase OS=Yersinia enterocolitica serotype O:8 / biotype 1B (strain NCTC 13174 / 8081) GN=ubiG PE=3 SV=1 52 156 6.0E-06
sp|B1JS96|UBIG_YERPY Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:3 (strain YPIII) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q66CZ4|UBIG_YERPS Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype I (strain IP32953) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|A4TNI8|UBIG_YERPP Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis (strain Pestoides F) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q1CFZ1|UBIG_YERPN Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Nepal516) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|A9R284|UBIG_YERPG Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Angola) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q8ZGR6|UBIG_YERPE Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|B2K9A4|UBIG_YERPB Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype IB (strain PB1/+) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q1C9H5|UBIG_YERPA Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pestis bv. Antiqua (strain Antiqua) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|A7FKF4|UBIG_YERP3 Ubiquinone biosynthesis O-methyltransferase OS=Yersinia pseudotuberculosis serotype O:1b (strain IP 31758) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q6D7X5|UBIG_PECAS Ubiquinone biosynthesis O-methyltransferase OS=Pectobacterium atrosepticum (strain SCRI 1043 / ATCC BAA-672) GN=ubiG PE=3 SV=1 62 156 6.0E-06
sp|Q81ZZ2|UBIG_NITEU Ubiquinone biosynthesis O-methyltransferase OS=Nitrosomonas europaea (strain ATCC 19718 / NBRC 14298) GN=ubiG PE=3 SV=1 50 156 7.0E-06
sp|A1S6C9|UBIG_SHEAM Ubiquinone biosynthesis O-methyltransferase OS=Shewanella amazonensis (strain ATCC BAA-1098 / SB2B) GN=ubiG PE=3 SV=1 22 156 9.0E-06
[Show less]

GO

GO Term Description Terminal node
GO:0008168 methyltransferase activity Yes
GO:0003674 molecular_function No
GO:0016741 transferase activity, transferring one-carbon groups No
GO:0016740 transferase activity No
GO:0003824 catalytic activity No

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
No 1 - 61 0.45

Transmembrane Domains

(None)

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|089240
MTTLVETKSSSVPYHLPKGGKKEFTRLDSQHRIWTWLVDGLYVPEIEEQLQQHMGRAKNPAILDVGCGSAIWSVG
MAERFPSAQVIGVDITTPNHRSFPSNFSFRNHNLVNGLPSEFKAKFDIIQCRTVCQHIPDPQALVDCMADCLKPD
GFLILADGDLSVGFDEDRKLLEPFIYDPSLSIQDNLKNTKGLSWHAGWLHAFSQATRSVKYESPLTMAQKSKLLK
EPTIKDLWIPYGWEGKDVKYGKEMGELTAEDFKHIYQFSGNTVFNKLDIPSEIKNALVERGLTEVSKRKTYLVGS
YVVARKYSEAEIQSSIPKNGST*
Coding >AgabiH97|089240
ATGACCACACTTGTAGAAACGAAAAGTTCATCTGTACCTTATCACCTACCTAAAGGAGGGAAGAAAGAATTCACC
AGACTTGACTCGCAACACAGGATATGGACTTGGTTGGTAGATGGATTATATGTACCAGAAATCGAAGAGCAACTC
CAACAACACATGGGACGGGCCAAAAATCCCGCAATTCTAGACGTTGGTTGTGGTTCAGCGATCTGGTCAGTTGGA
ATGGCCGAGCGTTTCCCTTCAGCTCAAGTGATAGGCGTAGACATAACTACTCCGAATCATAGATCTTTTCCATCG
AATTTCAGCTTCAGAAATCATAACCTCGTTAATGGGCTTCCGTCTGAGTTTAAAGCCAAGTTCGATATCATCCAG
TGCAGAACCGTGTGTCAACATATACCCGACCCTCAGGCATTGGTAGACTGCATGGCTGATTGTCTTAAGCCAGAC
GGCTTCCTTATATTAGCAGACGGAGACTTATCCGTAGGATTCGATGAAGATCGGAAACTTCTAGAACCATTCATC
TATGATCCCTCGCTGAGCATCCAAGATAATTTAAAGAACACCAAAGGATTATCTTGGCATGCTGGTTGGTTACAC
GCATTCTCTCAAGCCACCCGAAGCGTAAAATACGAGTCGCCTTTAACTATGGCTCAAAAATCAAAATTACTGAAG
GAGCCGACGATCAAGGATCTTTGGATTCCATATGGTTGGGAAGGGAAAGACGTAAAATATGGCAAAGAAATGGGC
GAACTAACAGCTGAGGATTTCAAACATATCTATCAATTCAGCGGCAACACTGTTTTCAACAAGTTAGATATTCCC
TCGGAGATCAAAAATGCTCTCGTTGAGAGAGGGCTGACAGAGGTTAGTAAACGGAAAACGTATCTGGTTGGTTCG
TACGTTGTCGCTAGGAAGTACAGCGAAGCTGAGATTCAATCGTCTATACCGAAGAATGGCTCTACTTAA
Transcript >AgabiH97|089240
ATGACCACACTTGTAGAAACGAAAAGTTCATCTGTACCTTATCACCTACCTAAAGGAGGGAAGAAAGAATTCACC
AGACTTGACTCGCAACACAGGATATGGACTTGGTTGGTAGATGGATTATATGTACCAGAAATCGAAGAGCAACTC
CAACAACACATGGGACGGGCCAAAAATCCCGCAATTCTAGACGTTGGTTGTGGTTCAGCGATCTGGTCAGTTGGA
ATGGCCGAGCGTTTCCCTTCAGCTCAAGTGATAGGCGTAGACATAACTACTCCGAATCATAGATCTTTTCCATCG
AATTTCAGCTTCAGAAATCATAACCTCGTTAATGGGCTTCCGTCTGAGTTTAAAGCCAAGTTCGATATCATCCAG
TGCAGAACCGTGTGTCAACATATACCCGACCCTCAGGCATTGGTAGACTGCATGGCTGATTGTCTTAAGCCAGAC
GGCTTCCTTATATTAGCAGACGGAGACTTATCCGTAGGATTCGATGAAGATCGGAAACTTCTAGAACCATTCATC
TATGATCCCTCGCTGAGCATCCAAGATAATTTAAAGAACACCAAAGGATTATCTTGGCATGCTGGTTGGTTACAC
GCATTCTCTCAAGCCACCCGAAGCGTAAAATACGAGTCGCCTTTAACTATGGCTCAAAAATCAAAATTACTGAAG
GAGCCGACGATCAAGGATCTTTGGATTCCATATGGTTGGGAAGGGAAAGACGTAAAATATGGCAAAGAAATGGGC
GAACTAACAGCTGAGGATTTCAAACATATCTATCAATTCAGCGGCAACACTGTTTTCAACAAGTTAGATATTCCC
TCGGAGATCAAAAATGCTCTCGTTGAGAGAGGGCTGACAGAGGTTAGTAAACGGAAAACGTATCTGGTTGGTTCG
TACGTTGTCGCTAGGAAGTACAGCGAAGCTGAGATTCAATCGTCTATACCGAAGAATGGCTCTACTTAA
Gene >AgabiH97|089240
ATGACCACACTTGTAGAAACGAAAAGTTCATCTGTACTTACACATCCTTCCAACGCGAAGCCAGCTCCTGACGTA
AACTCTTTTCAGGTACCTTATCACCTACCTAAAGGAGGGAAGAAAGAATTCACCGTTCGTTACTTTCCAAAGCGC
CTGCTTGAACTTCATCTAACTGACCATGCATGGATTTCCAGAGACTTGACTCGCAACACAGGATATGGACTTGGT
TGGTAGATGGATTATATGTACCAGAAATCGAAGAGCAACTCCAACAACACATGGGACGGGCCAAAAATCCCGCAA
TTCTAGACGTTGGTTGTGGTTCAGCGATCTGGTAAGCAGTTGAGCTGGTGCTTGAACGTTTCATTGAATTGAAAG
CTCCGACAGGTCAGTTGGAATGGCCGAGCGTTTCCCTTCAGCTCAAGTGATAGGCGTAGACATAACTACTCCGAA
TCATAGGTAAGAGCTTTCCGATAACGAAGAGCAATTCAAGTGACGACTTTAAAACAATTGCAATCATTAGATCTT
TTCCATCGAATTTCAGGTTCGAATTTTTTATCGTCGTTCTTTGACTTTACGAACTTACCAGACTATAATTTTTAC
AGCTTCAGAAATCATAACCTCGTTAATGGGCTTCCGTCTGAGTTTAAAGCCAAGTTCGATATCATCCAGTGCAGA
ACCGTGTGTCAACATGTAGGTATACATTCTCGCATGCATAGAGTCAATCTTTTAACGACAACTAGATACCCGACC
CTCAGGCATTGGTAGACTGCATGGCTGATTGTCTTAAGCCAGGTGAGTAGCTCATCGATAGTTGTGATTGCGATC
GATCATGAACTCACAATTGAGCCGTATTTTCAAGACGGCTTCCTTATATTAGCAGACGGAGACTTATCCGTAGGA
TTCGATGAAGATCGGAAACTTCTAGAACCATTCATCTATGATCCCTCGCTGAGCATCCAAGATAATTTAAAGAAC
ACCAAAGGATTATCTTGGCATGCTGGTTGGTTACACGCATTCTCTCAAGCCACCCGAAGCGTAAAATACGAGTCG
CCTTTAACTATGGCTCAAAAATCAAAATTACTGAAGGAGCCGACGATCAAGGATCTTTGGATTCCATATGGTTGG
GAAGGGAAAGACGTAAAATATGGCAAAGAAATGGGCGAACTAACAGCTGAGGATTTCAAAGTAAGTTCACCCGAG
GCTTGAGTTTGGCTCGACTGACTGCCTGTGGTATTTACAGCATATCTATCAATTCAGCGGCAACACTGTTTTCAA
CAAGTTAGATATTCCCTCGGAGATCAAAAATGCTCTCGTTGAGAGAGGGCTGACAGAGGTTAGTAAACGGAAAAC
GTATCTGGTTGGTTCGTACGTTGTCGCTAGGAAGTACAGCGAAGCTGAGATTCAATCGTCTATACCGAAGAATGG
CTCTACTTAA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail