Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|088650
Gene name
Locationscaffold_6:61365..62417
Strand+
Gene length (bp)1052
Transcript length (bp)951
Coding sequence length (bp)951
Protein length (aa) 317

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 53 72 19
2 92 114 22
3 134 156 22
4 168 190 22
5 210 232 22
6 274 296 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|088650
MSIFSSRLPTILLFFSLFHLEGVFGRGGGGGSGSGDGPDVSLDLSLTPEVEAVFALRIVIAIITLFQLGYSLKRF
KSLHLPEGEPILRYDTGMLFRILLTSYTVIYILYNSLYAVSTASRGGNFHLPLAFFPGTNFTGQLVAIVLFYATL
LSIVAYRQRLQLNPAKNILNLKTFLDGTLLVTILALGIAQDAVPGTGLNPNDPEDQKRIVILRNLIVAFQVFVSL
ASLNVAVSSFMARARLSKANIRDRIINICAFQCCQPDSLPLLSVELSDGLLIAAVVILGIVSIATVHFCLLMGAP
PKPPKSDKGAASEKKV*
Coding >AgabiH97|088650
ATGTCTATATTCTCCTCTCGACTTCCCACAATTCTACTATTTTTCTCGCTATTCCATTTAGAAGGAGTTTTTGGT
AGAGGTGGAGGAGGAGGCTCAGGCTCCGGAGACGGTCCTGATGTCAGCCTCGACCTTAGTCTTACCCCTGAAGTC
GAGGCAGTTTTCGCTCTGAGAATTGTCATTGCTATCATCACTCTTTTCCAACTGGGATATTCTCTGAAACGCTTC
AAAAGCCTTCATTTACCGGAGGGTGAACCCATTTTGCGTTATGATACAGGGATGCTATTCCGCATCCTCTTGACT
TCTTACACGGTTATCTATATCCTCTATAACTCACTCTATGCGGTTTCCACTGCCAGCCGTGGTGGTAACTTTCAT
TTACCTTTGGCGTTCTTCCCCGGAACAAATTTCACTGGCCAACTTGTCGCCATCGTCCTATTTTACGCCACCCTT
CTCTCCATCGTTGCATATCGTCAAAGACTCCAATTGAATCCTGCCAAAAACATCCTCAACTTGAAGACGTTTTTG
GATGGTACGCTGTTGGTGACTATCCTTGCTCTTGGTATTGCCCAGGATGCCGTACCTGGAACTGGGCTAAATCCC
AATGACCCAGAAGACCAGAAGAGGATTGTAATACTACGGAATCTTATTGTTGCGTTCCAGGTTTTCGTATCCCTT
GCGAGTCTAAATGTGGCGGTATCTTCGTTCATGGCCCGTGCCAGGCTATCCAAAGCCAATATTCGGGACAGGATT
ATAAATATCTGCGCCTTTCAATGCTGTCAGCCCGATAGTCTCCCACTGCTATCTGTGGAGTTATCAGACGGTTTG
TTGATCGCTGCTGTCGTCATCCTTGGAATCGTCTCTATTGCTACTGTTCATTTTTGCCTTCTCATGGGCGCTCCG
CCAAAGCCTCCGAAGTCGGATAAAGGAGCAGCTTCTGAGAAGAAAGTCTGA
Transcript >AgabiH97|088650
ATGTCTATATTCTCCTCTCGACTTCCCACAATTCTACTATTTTTCTCGCTATTCCATTTAGAAGGAGTTTTTGGT
AGAGGTGGAGGAGGAGGCTCAGGCTCCGGAGACGGTCCTGATGTCAGCCTCGACCTTAGTCTTACCCCTGAAGTC
GAGGCAGTTTTCGCTCTGAGAATTGTCATTGCTATCATCACTCTTTTCCAACTGGGATATTCTCTGAAACGCTTC
AAAAGCCTTCATTTACCGGAGGGTGAACCCATTTTGCGTTATGATACAGGGATGCTATTCCGCATCCTCTTGACT
TCTTACACGGTTATCTATATCCTCTATAACTCACTCTATGCGGTTTCCACTGCCAGCCGTGGTGGTAACTTTCAT
TTACCTTTGGCGTTCTTCCCCGGAACAAATTTCACTGGCCAACTTGTCGCCATCGTCCTATTTTACGCCACCCTT
CTCTCCATCGTTGCATATCGTCAAAGACTCCAATTGAATCCTGCCAAAAACATCCTCAACTTGAAGACGTTTTTG
GATGGTACGCTGTTGGTGACTATCCTTGCTCTTGGTATTGCCCAGGATGCCGTACCTGGAACTGGGCTAAATCCC
AATGACCCAGAAGACCAGAAGAGGATTGTAATACTACGGAATCTTATTGTTGCGTTCCAGGTTTTCGTATCCCTT
GCGAGTCTAAATGTGGCGGTATCTTCGTTCATGGCCCGTGCCAGGCTATCCAAAGCCAATATTCGGGACAGGATT
ATAAATATCTGCGCCTTTCAATGCTGTCAGCCCGATAGTCTCCCACTGCTATCTGTGGAGTTATCAGACGGTTTG
TTGATCGCTGCTGTCGTCATCCTTGGAATCGTCTCTATTGCTACTGTTCATTTTTGCCTTCTCATGGGCGCTCCG
CCAAAGCCTCCGAAGTCGGATAAAGGAGCAGCTTCTGAGAAGAAAGTCTGA
Gene >AgabiH97|088650
ATGTCTATATTCTCCTCTCGACTTCCCACAATTCTACTATTTTTCTCGCTATTCCATTTAGAAGGAGTTTTTGGT
AGAGGTGGAGGAGGAGGCTCAGGCTCCGGAGACGGTCCTGATGTCAGCCTCGACCTTAGTCTTACCCCTGAAGTC
GAGGCAGTTTTCGCTCTGAGAATTGTCATTGCTATCATCACTCTTTTCCAACTGGGATATTCTCTGAAACGCTTC
AAAAGCCTTCATTTACCGGAGGGTGAACCCATTTTGCGTTATGATACAGGGATGCTATTCCGCATCCTCTTGACT
TCTTACACGGTTATCTATATCCTCTATAACTCACTCTATGCGGTTTCCACTGCCAGCCGTGGTGGTAACTTTCAT
TTACCTTTGGCGTTCTTCCCCGGAACAAATTTCACTGGCCAACTTGTCGCCATCGTCCTATTTTACGCCACCCTT
CTCTCCATCGTTGCATATCGTCAAAGACTCCAATTGAATCCTGCCAAAAACATCCTCAACTTGAAGACGTTTTTG
GATGGTACGCTGTTGGTGACTATCCTTGCTCTTGGTATTGCCCAGGATGCCGTACCTGGAACTGGGCTAAATCCC
AATGACCCAGAAGACCAGAAGAGGATTGTAATACTACGGAATCTTATTGTTGCGTTCCAGGTTTTCGTATCCCTT
GCGAGTCTAAATGTGGCGGTATCTTCGTTCATGGCCCGTGCCAGGCTATCCAAAGCCAATATTCGGGACAGGGTA
TGTGAATAGCAAAATTTTCTTTCCTGATCTTTACATTCTCTCAAACAAGATTATAAATATCTGCGCCTTTCAATG
CTGTCAGCCCGATAGTCGTGTGTGGAGGCATATTTGGGATAATCGACGTTGGCATTGAATTTCAAGTCCCACTGC
TATCTGTGGAGTTATCAGACGGTTTGTTGATCGCTGCTGTCGTCATCCTTGGAATCGTCTCTATTGCTACTGTTC
ATTTTTGCCTTCTCATGGGCGCTCCGCCAAAGCCTCCGAAGTCGGATAAAGGAGCAGCTTCTGAGAAGAAAGTCT
GA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail