Fungal Genomics

at Utrecht University

General Properties

Protein IDAgabiH97|088640
Gene name
Locationscaffold_6:59259..60291
Strand+
Gene length (bp)1032
Transcript length (bp)978
Coding sequence length (bp)978
Protein length (aa) 326

Your browser does not support drawing a protein figure.

PFAM Domains

(None)

Swissprot hits

(None)

GO

(None)

SignalP

[Help with interpreting these statistics]
SignalP signal predicted Location
(based on Ymax)
D score
(significance: > 0.45)
Yes 1 - 26 0.5

Transmembrane Domains

Domain # Start End Length
1 46 68 22
2 97 119 22
3 134 156 22
4 168 190 22
5 210 232 22
6 245 267 22
7 282 304 22

Transcription Factor Class

(None)

Expression data

Analysis 1: Developmental stages of Agaricus bisporus (strain A15). Published in Pelkmans et al, Applied Microbiology and Biotechnology, 2016

Click here for more information

Sequences

Type of sequenceSequence
Locus Download genbank file of locus
The gene with 5 kb flanks (if sufficient flanking sequence is available). For use in cloning design programs. NOTE: features (genes or exons) that are only partially contained within the sequence are completely excluded.
Protein >AgabiH97|088640
MSPSSLRSVATLLILSFFHIEGVFARGKGKDVGDTAGNASDTGSDLGLSGILQAAFAMTIVIAVLTLYQLGTSLK
RFKSLQLPDGEPTLPYDVGILFRILLTSYTVMFIVNQALYATYIASFGDRFFLPEGFRIGMVFTGQFSTVLFYAT
PLSIIAYRQRIQLNPSENLFNLKTFLDGLLLAIILILGVAQDGLAATATFRKDFIALSDLGVAYDVFAFLASLNV
AISSFMARIRLSRAGVQDKIINISAFAVSPTVLAGGIFNIIDLGIRRNAGPFFNPDGLFIAYIVIGGIVSIATIA
WCLRMGAPPKPIKSDDKGVAVEKKV*
Coding >AgabiH97|088640
ATGTCACCTTCCTCCTTGCGAAGCGTCGCCACTCTGCTAATTCTCTCATTTTTCCACATAGAGGGAGTCTTTGCT
CGAGGTAAGGGGAAAGACGTAGGAGATACGGCTGGAAACGCGTCTGATACTGGCTCCGATCTTGGCCTCTCGGGC
ATACTCCAAGCAGCTTTCGCTATGACGATTGTCATCGCCGTCCTCACCCTCTACCAATTGGGAACTTCCCTGAAG
CGCTTTAAAAGCCTCCAATTACCGGACGGTGAACCCACTCTACCGTATGATGTGGGGATACTGTTCCGCATCCTC
TTGACGTCTTATACGGTCATGTTCATCGTTAATCAAGCACTATACGCGACCTATATCGCAAGCTTCGGTGATAGA
TTTTTTTTACCTGAAGGGTTCCGAATCGGCATGGTGTTCACTGGCCAGTTTTCCACTGTTTTATTTTATGCCACT
CCCCTCTCCATCATCGCATATCGCCAGAGAATCCAGCTGAACCCTAGCGAAAACCTGTTCAACCTGAAGACTTTT
TTGGATGGTTTGCTGTTGGCGATTATCCTTATTCTTGGTGTTGCCCAGGATGGCCTGGCTGCAACGGCGACGTTC
AGGAAAGATTTCATAGCATTATCAGACCTCGGTGTTGCGTACGATGTTTTTGCATTCCTGGCGAGTCTGAATGTG
GCGATATCTTCATTCATGGCTCGTATCAGACTTTCCAGAGCCGGTGTCCAGGACAAGATAATCAATATCTCCGCC
TTCGCGGTCAGTCCGACAGTCCTTGCTGGAGGCATTTTTAATATAATTGATCTTGGCATTCGACGCAATGCGGGA
CCATTTTTCAATCCTGATGGCCTGTTTATTGCTTACATTGTCATCGGTGGAATCGTCTCCATCGCCACTATCGCA
TGGTGCCTTCGCATGGGCGCACCACCCAAACCCATCAAATCTGATGATAAAGGAGTTGCTGTTGAGAAGAAAGTG
TGA
Transcript >AgabiH97|088640
ATGTCACCTTCCTCCTTGCGAAGCGTCGCCACTCTGCTAATTCTCTCATTTTTCCACATAGAGGGAGTCTTTGCT
CGAGGTAAGGGGAAAGACGTAGGAGATACGGCTGGAAACGCGTCTGATACTGGCTCCGATCTTGGCCTCTCGGGC
ATACTCCAAGCAGCTTTCGCTATGACGATTGTCATCGCCGTCCTCACCCTCTACCAATTGGGAACTTCCCTGAAG
CGCTTTAAAAGCCTCCAATTACCGGACGGTGAACCCACTCTACCGTATGATGTGGGGATACTGTTCCGCATCCTC
TTGACGTCTTATACGGTCATGTTCATCGTTAATCAAGCACTATACGCGACCTATATCGCAAGCTTCGGTGATAGA
TTTTTTTTACCTGAAGGGTTCCGAATCGGCATGGTGTTCACTGGCCAGTTTTCCACTGTTTTATTTTATGCCACT
CCCCTCTCCATCATCGCATATCGCCAGAGAATCCAGCTGAACCCTAGCGAAAACCTGTTCAACCTGAAGACTTTT
TTGGATGGTTTGCTGTTGGCGATTATCCTTATTCTTGGTGTTGCCCAGGATGGCCTGGCTGCAACGGCGACGTTC
AGGAAAGATTTCATAGCATTATCAGACCTCGGTGTTGCGTACGATGTTTTTGCATTCCTGGCGAGTCTGAATGTG
GCGATATCTTCATTCATGGCTCGTATCAGACTTTCCAGAGCCGGTGTCCAGGACAAGATAATCAATATCTCCGCC
TTCGCGGTCAGTCCGACAGTCCTTGCTGGAGGCATTTTTAATATAATTGATCTTGGCATTCGACGCAATGCGGGA
CCATTTTTCAATCCTGATGGCCTGTTTATTGCTTACATTGTCATCGGTGGAATCGTCTCCATCGCCACTATCGCA
TGGTGCCTTCGCATGGGCGCACCACCCAAACCCATCAAATCTGATGATAAAGGAGTTGCTGTTGAGAAGAAAGTG
TGA
Gene >AgabiH97|088640
ATGTCACCTTCCTCCTTGCGAAGCGTCGCCACTCTGCTAATTCTCTCATTTTTCCACATAGAGGGAGTCTTTGCT
CGAGGTAAGGGGAAAGACGTAGGAGATACGGCTGGAAACGCGTCTGATACTGGCTCCGATCTTGGCCTCTCGGGC
ATACTCCAAGCAGCTTTCGCTATGACGATTGTCATCGCCGTCCTCACCCTCTACCAATTGGGAACTTCCCTGAAG
CGCTTTAAAAGCCTCCAATTACCGGACGGTGAACCCACTCTACCGTATGATGTGGGGATACTGTTCCGCATCCTC
TTGACGTCTTATACGGTCATGTTCATCGTTAATCAAGCACTATACGCGACCTATATCGCAAGCTTCGGTGATAGA
TTTTTTTTACCTGAAGGGTTCCGAATCGGCATGGTGTTCACTGGCCAGTTTTCCACTGTTTTATTTTATGCCACT
CCCCTCTCCATCATCGCATATCGCCAGAGAATCCAGCTGAACCCTAGCGAAAACCTGTTCAACCTGAAGACTTTT
TTGGATGGTTTGCTGTTGGCGATTATCCTTATTCTTGGTGTTGCCCAGGATGGCCTGGCTGCAACGGCGACGTTC
AGGAAAGATTTCATAGCATTATCAGACCTCGGTGTTGCGTACGATGTTTTTGCATTCCTGGCGAGTCTGAATGTG
GCGATATCTTCATTCATGGCTCGTATCAGACTTTCCAGAGCCGGTGTCCAGGACAAGGTATGAGAAACGGCACAA
ACTTATTGTCCGATTGCTTACGTTCTCTCAAAAAAGATAATCAATATCTCCGCCTTCGCGGTCAGTCCGACAGTC
CTTGCTGGAGGCATTTTTAATATAATTGATCTTGGCATTCGACGCAATGCGGGACCATTTTTCAATCCTGATGGC
CTGTTTATTGCTTACATTGTCATCGGTGGAATCGTCTCCATCGCCACTATCGCATGGTGCCTTCGCATGGGCGCA
CCACCCAAACCCATCAAATCTGATGATAAAGGAGTTGCTGTTGAGAAGAAAGTGTGA

© 2022 - Robin Ohm - Utrecht University - The Netherlands

Built with Python Django and Wagtail